DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser7 and CG16998

DIOPT Version :9

Sequence 1:NP_572582.1 Gene:Ser7 / 31917 FlyBaseID:FBgn0019929 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_648134.1 Gene:CG16998 / 38847 FlyBaseID:FBgn0035795 Length:258 Species:Drosophila melanogaster


Alignment Length:290 Identity:80/290 - (27%)
Similarity:121/290 - (41%) Gaps:68/290 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   124 CG---SAFS--FRLVGGHNTGLFEFPWTTLLEYETVSGGKDYACGASFIAQRWLLTAAHCIHTMG 183
            ||   ||.|  .|:|||....:...||...:   ||.|  :|:|.::.|...||:||.||:..  
  Fly    12 CGHKTSALSPQERIVGGVEVPIHLTPWLASI---TVHG--NYSCSSALITSLWLVTAGHCVQY-- 69

  Fly   184 RNLTAAILGEWNRDTDPDCEN--------DLNGVRECAPPHIRVTIDRILPHAQYSELNYRNDIA 240
                            ||..:        |..|.|.        .:..::.|..::.....||||
  Fly    70 ----------------PDSYSVRAGSTFTDGGGQRR--------NVVSVILHPDFNLRTLENDIA 110

  Fly   241 LLRLSRPVNWLQMQNLEPVCLP-PQRGRYANQLAGSAADVSGWGK---TESSGSSKIKQKAMLHI 301
            ||:|.:  ::....|::.|.|| |........|.     |:|||.   |:|....::: ..::.:
  Fly   111 LLKLDK--SFTLGGNIQVVKLPLPSLNILPRTLL-----VAGWGNPDATDSESEPRLR-GTVVKV 167

  Fly   302 QPQDQCQEAFYKDTKITLADSQMCAGGEIGVDSCSGDSGGPLTVEANTASGNRYVYLAGVVSIGR 366
            ..|..||. .|......:.|..:||.| .|.|.|.||||.||     ...|:.|    |:||...
  Fly   168 INQRLCQR-LYSHLHRPITDDMVCAAG-AGRDHCYGDSGAPL-----VHRGSSY----GIVSFAH 221

  Fly   367 KHCGTALFSGIYTRVSSYMDWIESTIRANR 396
             .|....|.|:|||:::|:.||.:.:..:|
  Fly   222 -GCADPHFPGVYTRLANYVTWIFNVLENDR 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser7NP_572582.1 CLIP 29..74 CDD:197829
Tryp_SPc 131..388 CDD:214473 72/268 (27%)
Tryp_SPc 133..391 CDD:238113 73/269 (27%)
CG16998NP_648134.1 Tryp_SPc 24..242 CDD:214473 72/268 (27%)
Tryp_SPc 25..242 CDD:238113 71/267 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.