DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser7 and CG10469

DIOPT Version :9

Sequence 1:NP_572582.1 Gene:Ser7 / 31917 FlyBaseID:FBgn0019929 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_648025.1 Gene:CG10469 / 38696 FlyBaseID:FBgn0035678 Length:267 Species:Drosophila melanogaster


Alignment Length:286 Identity:77/286 - (26%)
Similarity:121/286 - (42%) Gaps:62/286 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   130 FRLVGGHNTGLF-----------EFPWTT-LLEYETVSGGKD--YACGASFIAQRWLLTAAHCIH 180
            |.||.|..||..           :.|:.. ||.|  ..|.||  ..||.:.::.||::|||||:.
  Fly    11 FSLVFGQETGSLRIMNGTAAKAKQLPYQVGLLCY--FEGSKDEPNMCGGTILSNRWIITAAHCLQ 73

  Fly   181 TMGRNLTAAILGEWNRDTDPDCENDLNGVRECAPPHIRVTIDRILPHAQYSELNYRNDIALLRLS 245
            ....||...::             .:..|:......|.|.....:.|.::......|||||::|.
  Fly    74 DPKSNLWKVLI-------------HVGKVKSFDDKEIVVNRSYTIVHKKFDRKTVTNDIALIKLP 125

  Fly   246 RPVNWLQMQNLEPVCLPPQRGRYANQLAGSAADVSGWGKTESSGSSKIKQKAMLHIQPQDQCQEA 310
            :.:.:  .:.::|..||..:..|    .|..|.:||||.|.....|::.|.....|....:|:..
  Fly   126 KKLTF--NKYIQPAKLPSAKKTY----TGRKAIISGWGLTTKQLPSQVLQYIRAPIISNKECERQ 184

  Fly   311 FYKD----TKITLADSQMCAGGEIGVDSCSGDSGGPLTVEANTASGNRYVYLAGVVSIGRKHCGT 371
            :.|.    :|..:.:..:|...:.|: .|.||||||:.::    .|:|  .|.|:||.|      
  Fly   185 WNKQLGGKSKKVVHNGFICIDSKKGL-PCRGDSGGPMVLD----DGSR--TLVGIVSHG------ 236

  Fly   372 ALFSG--------IYTRVSSYMDWIE 389
              |.|        :.||||||:.||:
  Fly   237 --FDGECKLKLPDVSTRVSSYLKWIK 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser7NP_572582.1 CLIP 29..74 CDD:197829
Tryp_SPc 131..388 CDD:214473 74/282 (26%)
Tryp_SPc 133..391 CDD:238113 75/283 (27%)
CG10469NP_648025.1 Tryp_SPc 23..259 CDD:214473 69/271 (25%)
Tryp_SPc 24..260 CDD:238113 70/271 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.