DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser7 and CG6592

DIOPT Version :9

Sequence 1:NP_572582.1 Gene:Ser7 / 31917 FlyBaseID:FBgn0019929 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_648016.1 Gene:CG6592 / 38687 FlyBaseID:FBgn0035669 Length:438 Species:Drosophila melanogaster


Alignment Length:297 Identity:77/297 - (25%)
Similarity:126/297 - (42%) Gaps:41/297 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   107 TTPRPPSGIDQLPEHPYCGSAFSFRLVGGHNTGLFEFPWTTLLEYETVSGGKDYACGASFIAQRW 171
            |||....   .|||    |:....|:.||.......||:...:..:...|  .|.||.|.|:.:.
  Fly   105 TTPLMEK---MLPE----GAMAMDRIFGGDVGNPHCFPYQVGMLLQRPKG--LYWCGGSLISDKH 160

  Fly   172 LLTAAHCIHTMGRNLTAAILGEWNRDTDPDCENDLNGVRECAPPHIRVTIDRILPHAQYSELNYR 236
            ::|||||:....|.|  ..||          .|::...:|.....:.|..:....:..::....:
  Fly   161 VITAAHCVDMAKRAL--VFLG----------ANEIKNAKEKGQVRLMVPSENFQIYPTWNPKRLK 213

  Fly   237 NDIALLRLSRPVNWLQMQNLEPVCLPPQRGRYANQLAGSAADVSGWGK--TESSGSSKIKQKAML 299
            :|||::||...|::  .:.:.|:.||.:...| .......|..||||:  |.....|.:.:...|
  Fly   214 DDIAIVRLPHAVSF--NERIHPIQLPKRHYEY-RSFKNKLAIASGWGRYATGVHAISNVLRYVQL 275

  Fly   300 HIQPQDQCQEAF---YKDTKITLADSQMCAGGEIGVDSCSGDSGGPLTVEANTASGNRYVYLAGV 361
            .|.....|:..|   |:.|.|       |..|.....:|:|||||||.::...:...   .|.|:
  Fly   276 QIIDGRTCKSNFPLSYRGTNI-------CTSGRNARSTCNGDSGGPLVLQRRHSKKR---VLVGI 330

  Fly   362 VSIGRKHCGTALFSGIYTRVSSYMDWI--ESTIRANR 396
            .|.|..:.....:...:|:|:||:|||  |:.:.|::
  Fly   331 TSFGSIYGCDRGYPAAFTKVASYLDWISDETGVSAHQ 367

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser7NP_572582.1 CLIP 29..74 CDD:197829
Tryp_SPc 131..388 CDD:214473 66/261 (25%)
Tryp_SPc 133..391 CDD:238113 68/264 (26%)
CG6592NP_648016.1 Tryp_SPc 122..357 CDD:214473 66/261 (25%)
Tryp_SPc 123..359 CDD:238113 67/262 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.