DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser7 and CG6462

DIOPT Version :9

Sequence 1:NP_572582.1 Gene:Ser7 / 31917 FlyBaseID:FBgn0019929 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_648011.1 Gene:CG6462 / 38681 FlyBaseID:FBgn0035663 Length:319 Species:Drosophila melanogaster


Alignment Length:277 Identity:74/277 - (26%)
Similarity:117/277 - (42%) Gaps:35/277 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   126 SAFSFRLVGGH--NTGLFEFPWTTLLEYETVSGGKDYACGASFIAQRWLLTAAHCIHTMGRNLTA 188
            :|...|:.||.  ..|:|.:....:::   :||.....||.|.|..:::||||||       ||.
  Fly    71 AAVRTRIAGGELATRGMFPYQVGLVIQ---LSGADLVKCGGSLITLQFVLTAAHC-------LTD 125

  Fly   189 AILGE--WNRDTDPDCENDLNGVRECAPPHIRVTIDRILPHAQYSELNYRNDIALLRLSRPVNWL 251
            ||..:  .......|.|:.:.        .::||....:.:..|......:|:||:||.|.|.  
  Fly   126 AIAAKIYTGATVFADVEDSVE--------ELQVTHRDFIIYPDYLGFGGYSDLALIRLPRKVR-- 180

  Fly   252 QMQNLEPVCLPPQRGRYANQ--LAGSAADVSGWGKTESSGSSKIKQKAMLHIQPQDQCQEAFYKD 314
            ..:.::|:.|   .|.:.:|  |.|....:||||....|...:.:....|..:..||.:...|..
  Fly   181 TSEQVQPIEL---AGEFMHQNFLVGKVVTLSGWGYLGDSTDKRTRLLQYLDAEVIDQERCICYFL 242

  Fly   315 TKITLADSQMCAGGEIGVDSCSGDSGGPLTVEANTASGNRYVYLAGVVSIGRKHCGTALFSGIYT 379
            ..:......:|..|..|..:|:||||||:.......|     ||.||.|.|...........:||
  Fly   243 PGLVSQRRHLCTDGSNGRGACNGDSGGPVVYHWRNVS-----YLIGVTSFGSAEGCEVGGPTVYT 302

  Fly   380 RVSSYMDWI-ESTIRAN 395
            |:::|:.|| :.|...|
  Fly   303 RITAYLPWIRQQTAMTN 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser7NP_572582.1 CLIP 29..74 CDD:197829
Tryp_SPc 131..388 CDD:214473 69/262 (26%)
Tryp_SPc 133..391 CDD:238113 70/264 (27%)
CG6462NP_648011.1 Tryp_SPc 76..311 CDD:214473 69/262 (26%)
Tryp_SPc 77..314 CDD:238113 70/264 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.