DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser7 and mas

DIOPT Version :9

Sequence 1:NP_572582.1 Gene:Ser7 / 31917 FlyBaseID:FBgn0019929 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_523919.1 Gene:mas / 38499 FlyBaseID:FBgn0011653 Length:1047 Species:Drosophila melanogaster


Alignment Length:280 Identity:87/280 - (31%)
Similarity:129/280 - (46%) Gaps:47/280 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   131 RLVGGHNTGLFEFPWTTLLEYETVSGGKDYACGASFIAQRWLLTAAHCIHTMGRNLTAAI--LGE 193
            |:|||.:....|:.|...|    ::....|.|||:.|..:|:||||||:..:.|:..|..  :|:
  Fly   802 RVVGGEDGENGEWCWQVAL----INSLNQYLCGAALIGTQWVLTAAHCVTNIVRSGDAIYVRVGD 862

  Fly   194 WNRDTDPDCENDLNGVRECAPP---HIRVTIDRILPHAQYSELNYRNDIALLRLSRPVNWLQMQN 255
            :          ||  .|:...|   .:||....|  |..::.....||||||:|..     |.:.
  Fly   863 Y----------DL--TRKYGSPGAQTLRVATTYI--HHNHNSQTLDNDIALLKLHG-----QAEL 908

  Fly   256 LEPVCLP--PQRGRYANQLAGSAADVSGWGKTESSGSSKIK-QKAMLHIQPQDQCQEAFYKDTKI 317
            .:.|||.  |.||  .:..||....|:|:|....:|...:: ::|.:.|....:|   ..|...:
  Fly   909 RDGVCLVCLPARG--VSHAAGKRCTVTGYGYMGEAGPIPLRVREAEIPIVSDTEC---IRKVNAV 968

  Fly   318 T-----LADSQMCAGGEIGVDSCSGDSGGPLTVEANTASGNRYVYLAGVVSIGRKHCGTALFSGI 377
            |     |..|..|||||.|.|:|.||.||||..:     .:.:..|||:||.| ..||.....|:
  Fly   969 TEKIFILPASSFCAGGEEGHDACQGDGGGPLVCQ-----DDGFYELAGLVSWG-FGCGRQDVPGV 1027

  Fly   378 YTRVSSYMDWIESTIRANRI 397
            |.:.||::.||...|..|.:
  Fly  1028 YVKTSSFIGWINQIISVNNL 1047

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser7NP_572582.1 CLIP 29..74 CDD:197829
Tryp_SPc 131..388 CDD:214473 83/269 (31%)
Tryp_SPc 133..391 CDD:238113 84/270 (31%)
masNP_523919.1 Tryp_SPc 803..1041 CDD:238113 84/271 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455934
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24258
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.