DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser7 and CG1299

DIOPT Version :9

Sequence 1:NP_572582.1 Gene:Ser7 / 31917 FlyBaseID:FBgn0019929 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_647862.1 Gene:CG1299 / 38496 FlyBaseID:FBgn0035501 Length:511 Species:Drosophila melanogaster


Alignment Length:382 Identity:113/382 - (29%)
Similarity:168/382 - (43%) Gaps:64/382 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 CNSVEFGRGTCIEKKDCDFYAVDKLMELASKQQ------------CFSRQRPDLVCCPRETNIIP 81
            |...:...|.|:|.|:|    ...|.||.|:.|            ...:.:...||||       
  Fly   164 CRGPDTKPGNCVEIKEC----ASLLNELRSRSQDATFANFLRASNAVCQNKGTQVCCP------- 217

  Fly    82 PLAPRISNGTTNATSSTTTLKLLPRTTPRPPSGIDQLPEHPYCGSAFSF--RLVGGHNTGLFEFP 144
                 ...|.||.|.:.:  :::|:.|...|..:..:.|.  |||...:  ::|||..:....:|
  Fly   218 -----TGQGITNTTPAPS--QIVPKNTDEIPRRLLNVEEG--CGSTVGYFKKIVGGEVSRKGAWP 273

  Fly   145 WTTLLEYETVSGGKDYACGASFIAQRWLLTAAHCIHTMGRNLTAAILGEWNRDTDPDCENDLNGV 209
            |..||.|:..| |..:.||.:.|..|.:|||||||.   ::|....|||.:..||.:        
  Fly   274 WIALLGYDDPS-GSPFKCGGTLITARHVLTAAHCIR---QDLQFVRLGEHDLSTDTE-------- 326

  Fly   210 RECAPPHIRVTIDRILPHAQYSELNYRNDIALLRLSRPVNWLQMQNLEPVCLPPQRGRYANQLAG 274
                ..|:.:.|.|.:.|..|:..|.|:|:|:|.|.|.|.:  ...:.|:|||...........|
  Fly   327 ----TGHVDINIARYVSHPDYNRRNGRSDMAILYLERNVEF--TSKIAPICLPHTANLRQKSYVG 385

  Fly   275 SAADVSGWGKTESSG-SSKIKQKAMLHIQPQDQCQEAFYKDTKITLAD----SQMCAG---GEIG 331
            ....|:|||||...| |:::..:..:.|.....|.:::.|:.:...||    :.:|||   |  |
  Fly   386 YMPFVAGWGKTMEGGESAQVLNELQIPIYDNKVCVQSYAKEKRYFSADQFDKAVLCAGVLSG--G 448

  Fly   332 VDSCSGDSGGPLTVEANTASGNRYVYLAGVVSIGRKHCGTALFSGIYTRVSSYMDWI 388
            .|:|.|||||||.: .....|....||.||||.| ..|......|:|:....:||||
  Fly   449 KDTCQGDSGGPLML-PEPYQGQLRFYLIGVVSYG-IGCARPNVPGVYSSTQYFMDWI 503

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser7NP_572582.1 CLIP 29..74 CDD:197829 13/56 (23%)
Tryp_SPc 131..388 CDD:214473 85/264 (32%)
Tryp_SPc 133..391 CDD:238113 87/264 (33%)
CG1299NP_647862.1 CLIP 37..93 CDD:197829
CLIP 164..216 CDD:288855 12/55 (22%)
Tryp_SPc 260..503 CDD:214473 85/264 (32%)
Tryp_SPc 261..503 CDD:238113 85/263 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D402896at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.