DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser7 and CG14990

DIOPT Version :9

Sequence 1:NP_572582.1 Gene:Ser7 / 31917 FlyBaseID:FBgn0019929 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_647856.2 Gene:CG14990 / 38486 FlyBaseID:FBgn0035496 Length:322 Species:Drosophila melanogaster


Alignment Length:332 Identity:101/332 - (30%)
Similarity:144/332 - (43%) Gaps:74/332 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 APRISNGTTNATSSTTTLKLLPRTTPRPPSGIDQLPEHPYCGSAFSFRLVGG------HNT-GLF 141
            ||.|.||    .|.|..|:      |.|         :..||.:....||..      ::| |  
  Fly    27 APGIFNG----MSFTENLQ------PDP---------NQVCGMSNPNGLVANVKVPKDYSTPG-- 70

  Fly   142 EFPWTTLLEYETVSGGKDYACGASFIAQRWLLTAAHCIHTMGRNLTAAIL--GEWNRDTDPDCEN 204
            :|||...|    .|.||.:..| |.||...:||||..:  :|:.....::  ||||         
  Fly    71 QFPWVVAL----FSQGKYFGAG-SLIAPEVVLTAASIV--VGKTDAEIVVRAGEWN--------- 119

  Fly   205 DLNGVR-ECAPPHIRVTIDRILPHAQYSELNYRNDIALLRLSRPVNWLQMQNLEPVCLPPQRGRY 268
              .|.| |..|...| .:.|::.|.::|.|...|:||||.|:.|..  ...::..:|||.| ||.
  Fly   120 --TGQRSEFLPSEDR-PVARVVQHREFSYLLGANNIALLFLANPFE--LKSHIRTICLPSQ-GRS 178

  Fly   269 ANQLAGSAADVSGWGKT--ESSGSSKIKQKAMLHIQPQDQCQEAFYKDTKI----TLADSQMCAG 327
            .:|   ....|:||||.  .....|.|::|..|.:..:.|||:.. ::|::    .|..|.:|||
  Fly   179 FDQ---KRCLVTGWGKVAFNDENYSNIQKKIELPMINRAQCQDQL-RNTRLGVSFDLPASLICAG 239

  Fly   328 GEIGVDSCSGDSGGPL--TVEANTASGNRYVYLAGVVS--IGRKHCGTALFSGIYTRVSSYMDWI 388
            ||.....|.||.|..|  .:||:.   :||.. ||:|:  ||   |.......:||.|..:.|||
  Fly   240 GEKDAGDCLGDGGSALFCPMEADP---SRYEQ-AGIVNWGIG---CQEENVPAVYTNVEMFRDWI 297

  Fly   389 ESTIRAN 395
            ...:..|
  Fly   298 YEHMAQN 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser7NP_572582.1 CLIP 29..74 CDD:197829
Tryp_SPc 131..388 CDD:214473 86/276 (31%)
Tryp_SPc 133..391 CDD:238113 87/277 (31%)
CG14990NP_647856.2 Tryp_SPc 67..300 CDD:238113 86/267 (32%)
Tryp_SPc 67..297 CDD:214473 84/264 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.