DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser7 and CG32277

DIOPT Version :9

Sequence 1:NP_572582.1 Gene:Ser7 / 31917 FlyBaseID:FBgn0019929 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_728835.1 Gene:CG32277 / 38393 FlyBaseID:FBgn0052277 Length:261 Species:Drosophila melanogaster


Alignment Length:290 Identity:80/290 - (27%)
Similarity:120/290 - (41%) Gaps:75/290 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   126 SAFSFR---LVGGHNTGLFEFPWTTLLEYETVSGGKDYACGASFIAQRWLLTAAHCI---HTMGR 184
            |.|:.|   :.||..|.:.:..:...|.    .||| :.||...|:...:||||||:   :...|
  Fly    18 SLFTLRQGKIFGGKTTLVKDHSFLVNLR----RGGK-FRCGGVIISPNCVLTAAHCLEGRYQQVR 77

  Fly   185 NLTAAILGEWNRDTDPDCENDLNGVRECAPPHIRVTIDRILPHAQYSEL--NY------RNDIAL 241
            :||.        .....|..|     :..|.|:|        .|.|..|  ||      .:|:|:
  Fly    78 DLTV--------HAQQQCLGD-----DMPPEHVR--------SAWYVGLSPNYCAQRGLDSDLAV 121

  Fly   242 LRLSRPVNWLQMQNLEPV---CLPPQRGRYANQLAGSAADVSGWGKTESSGS--SKIKQKAMLHI 301
            :|||||.:.....:|..:   .|||.          |...|.|||.....|.  ::..|:|.:.:
  Fly   122 IRLSRPFDIAGNASLVKIDYNDLPPH----------SNLTVLGWGAINEQGHNWNQCLQEANVKL 176

  Fly   302 QPQDQCQEAFYKD-TKITLADSQMCAGGEIGVDSCSGDSGGPLTVEANTASGNRYVYLAGVVSIG 365
            ....:|.::.... .|:|  ::..||.|:...|:|.||||||......:         .|:||.|
  Fly   177 ISHRECIKSVGSGWQKVT--NNMFCALGKNARDACQGDSGGPAIYAGRS---------VGIVSWG 230

  Fly   366 RKHCGTALFSGIYTRVSS------YMDWIE 389
             ..||:. :.|:|||:||      ..|:||
  Fly   231 -YGCGSG-YPGVYTRLSSPSITYWLKDFIE 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser7NP_572582.1 CLIP 29..74 CDD:197829
Tryp_SPc 131..388 CDD:214473 76/282 (27%)
Tryp_SPc 133..391 CDD:238113 77/280 (28%)
CG32277NP_728835.1 Tryp_SPc 26..246 CDD:214473 72/268 (27%)
Tryp_SPc 27..246 CDD:238113 72/267 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455962
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.