DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser7 and CG32271

DIOPT Version :9

Sequence 1:NP_572582.1 Gene:Ser7 / 31917 FlyBaseID:FBgn0019929 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_728833.1 Gene:CG32271 / 38392 FlyBaseID:FBgn0052271 Length:248 Species:Drosophila melanogaster


Alignment Length:278 Identity:69/278 - (24%)
Similarity:121/278 - (43%) Gaps:50/278 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   122 PYCGSA---FSFRLVGGHNTGLFEFPWTTLLEYETVSGGKDYACGASFIAQRWLLTAAHCIHTMG 183
            |.|.:|   .:.|:|||....:...|:...|..     |.::.||.|.:..:.::|||||:..:|
  Fly    12 PLCWAASNEANSRIVGGVPVDIASVPYLVNLRI-----GGNFMCGGSLVTPQHVVTAAHCVKGIG 71

  Fly   184 --RNLTAAILGEWNRDTDPDCENDLNGVRECAPPHIRVTIDRILPHAQYSELNYRNDIALLRLSR 246
              |.|..|                  ||.......:|..:|::.....|:.....:|:|:|:|..
  Fly    72 ASRILVVA------------------GVTRLTETGVRSGVDKVYTPKAYNTRTLTSDVAVLKLKA 118

  Fly   247 PVNWLQMQNLEPVCLPPQRGRYANQLAGSAADVSGWGK-TESSGSSKIKQKAM-LHIQPQDQCQE 309
            |::..::..:| :|       ..:..||....|||||: ||.:.:..::.::: :.:.|:..|..
  Fly   119 PISGPKVSTIE-LC-------NTSFKAGDLIKVSGWGQITERNKAVSMQVRSVDVALIPRKACMS 175

  Fly   310 AFYKDTKITLADSQMCAGGEIGVDSCSGDSGGPLTVEANTASGNRYVYLAGVVSIGRKHCGTALF 374
            . || .:.|:.::..||......|:|.||||||...:..         |.|:||.| ..|.....
  Fly   176 Q-YK-LRGTITNTMFCASVPGVKDACEGDSGGPAVYQGQ---------LCGIVSWG-VGCARKSS 228

  Fly   375 SGIYTRVSSYMDWIESTI 392
            .|:||.|.:...:|:..:
  Fly   229 PGVYTNVKTVRSFIDKAL 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser7NP_572582.1 CLIP 29..74 CDD:197829
Tryp_SPc 131..388 CDD:214473 65/260 (25%)
Tryp_SPc 133..391 CDD:238113 65/261 (25%)
CG32271NP_728833.1 Tryp_SPc 24..242 CDD:214473 65/260 (25%)
Tryp_SPc 25..244 CDD:238113 65/261 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.