DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser7 and KLK1

DIOPT Version :9

Sequence 1:NP_572582.1 Gene:Ser7 / 31917 FlyBaseID:FBgn0019929 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_002248.1 Gene:KLK1 / 3816 HGNCID:6357 Length:262 Species:Homo sapiens


Alignment Length:276 Identity:88/276 - (31%)
Similarity:120/276 - (43%) Gaps:49/276 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   131 RLVGGHNTGLFEFPW-TTLLEYETVSGGKDYACGASFIAQRWLLTAAHCIHT-----MGR-NLTA 188
            |:|||........|| ..|..:.|      :.||...:.::|:|||||||..     :|| ||. 
Human    24 RIVGGWECEQHSQPWQAALYHFST------FQCGGILVHRQWVLTAAHCISDNYQLWLGRHNLF- 81

  Fly   189 AILGEWNRDTDPDCENDLNGVRECAP-PHIRVTIDRILPHAQYSELNYRNDIALLRLSRPVNWLQ 252
                        |.||....|..... ||....:..:..|.:.::.:|.:|:.||||:.|.:.: 
Human    82 ------------DDENTAQFVHVSESFPHPGFNMSLLENHTRQADEDYSHDLMLLRLTEPADTI- 133

  Fly   253 MQNLEPVCLPPQRGRYANQLAGSAADVSGWGKTESSGSS--KIKQKAMLHIQPQDQCQEAFYKDT 315
            ...::.|.||.:...     .||....||||..|....|  ...|...|.|.|.|:|::|..:  
Human   134 TDAVKVVELPTEEPE-----VGSTCLASGWGSIEPENFSFPDDLQCVDLKILPNDECKKAHVQ-- 191

  Fly   316 KITLADSQMCAGG-EIGVDSCSGDSGGPLTVEANTASGNRYVYLAGVVSIGRKHCGTALFSGIYT 379
            |:|  |..:|.|. |.|.|:|.|||||||..:.         .|.||.|.|...|||.....:..
Human   192 KVT--DFMLCVGHLEGGKDTCVGDSGGPLMCDG---------VLQGVTSWGYVPCGTPNKPSVAV 245

  Fly   380 RVSSYMDWIESTIRAN 395
            ||.||:.|||.||..|
Human   246 RVLSYVKWIEDTIAEN 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser7NP_572582.1 CLIP 29..74 CDD:197829
Tryp_SPc 131..388 CDD:214473 82/267 (31%)
Tryp_SPc 133..391 CDD:238113 84/268 (31%)
KLK1NP_002248.1 Tryp_SPc 25..257 CDD:238113 84/269 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.