DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser7 and CG30414

DIOPT Version :9

Sequence 1:NP_572582.1 Gene:Ser7 / 31917 FlyBaseID:FBgn0019929 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_001163264.1 Gene:CG30414 / 37705 FlyBaseID:FBgn0050414 Length:305 Species:Drosophila melanogaster


Alignment Length:297 Identity:93/297 - (31%)
Similarity:136/297 - (45%) Gaps:60/297 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   124 CGSA---FSFRLVGGHNTGLFEFPWTTLLEYETVSGGKDYACGASFIAQRWLLTAAHCIHTM--- 182
            ||:.   |...:.||.:.|||..||..     .|.|.|  .||.|.|..|::|||||||.:.   
  Fly    30 CGTTKPEFIPMITGGADAGLFSNPWMV-----KVLGEK--LCGGSLITSRFVLTAAHCIVSTHMR 87

  Fly   183 -----------GRNLTAAI----------LGEWN-RDTDPDCENDLNGVRECAPPHIRVTIDRIL 225
                       |::.:..:          |||:: |....||         |.|....:.:||.:
  Fly    88 VRLGEYKTRFPGKDCSRCVPKSYKLRRIRLGEYDTRFPGKDC---------CVPKSYELAVDRKI 143

  Fly   226 PHAQYSELNYRNDIALLRLSRPVNWLQMQNLEPVCLPPQRGRYANQLAGSAADVSGWGKTESSGS 290
            .||.|: ||..|||.|||:...|.:  ...:.|:||..: |..|.   ....:::|||.|.....
  Fly   144 LHADYN-LNLDNDIGLLRMKSFVQY--SDYVRPICLLVE-GHMAE---SPIFNITGWGVTNDGTP 201

  Fly   291 SKIKQKAMLHIQPQDQCQEAFYKDTKITLADSQMCAGGEIGVDSCSGDSGGPLTVEANTASGNRY 355
            |:..|:|.::......|:..|.|.    :.:||:||.| ...|:|.|||||||:.:...| |:..
  Fly   202 SRRLQRATVYNTDLHFCRSKFTKQ----VDESQICAAG-TNSDACHGDSGGPLSAQVPFA-GSWL 260

  Fly   356 VYLAGVVSIGRKHCGTALFSGIYTRVSSYMDWIESTI 392
            .:..|:||.|...|.:  || :||.|:.:.|||.:.|
  Fly   261 TFQYGLVSYGSAACHS--FS-VYTNVTHHRDWIVNAI 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser7NP_572582.1 CLIP 29..74 CDD:197829
Tryp_SPc 131..388 CDD:214473 87/281 (31%)
Tryp_SPc 133..391 CDD:238113 89/282 (32%)
CG30414NP_001163264.1 Tryp_SPc 41..290 CDD:214473 87/280 (31%)
Tryp_SPc 41..290 CDD:238113 87/280 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.