DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser7 and CG3700

DIOPT Version :9

Sequence 1:NP_572582.1 Gene:Ser7 / 31917 FlyBaseID:FBgn0019929 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster


Alignment Length:399 Identity:107/399 - (26%)
Similarity:153/399 - (38%) Gaps:102/399 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 GRGTCIE--KKDCD--FYAVDKLMELASKQQCFSRQRPDLVCCP---RETNIIP-----PLAPRI 87
            |.|.|.|  ..||.  ||.    ..|...:..:..:..|:||||   ...|:.|     |...:.
  Fly    26 GTGECKELTPSDCPVIFYN----QHLIGAEVKYCDEFNDIVCCPIPLDHQNLKPAEQTRPFEKQC 86

  Fly    88 S--NGTTNATSSTTTLKLLPRTTPRPPSGIDQLPEHPYCGSAFSFRLVGGHNTGLFEFPWTTLLE 150
            .  |...:|..||                       |:        :|||......|||:..|:.
  Fly    87 KQYNEVRSACQST-----------------------PF--------IVGGTKASGKEFPFMALIG 120

  Fly   151 YETVSGGK---DYACGASFIAQRWLLTAAHCIHT-------MGRNLTA----AILGE--WNRDTD 199
            ....:..|   ::.||.|.:..:::||||||:.|       :..|..:    ..|||  :|..||
  Fly   121 THRPNKSKSDINWDCGGSVVHPKFVLTAAHCLETDESKAERLDPNFDSPKFVVRLGELDYNSTTD 185

  Fly   200 PDCENDLNGVRECAPPHIRVTIDRILPHAQYSELNYRNDIALLRLSRPVNWLQMQNLEPVCLPPQ 264
            .....|...|.....|..         ..:..|..::|||||:.|.|...:  ..::..|||||.
  Fly   186 DALVQDFRVVNYVVHPGY---------DTEDEEQGFKNDIALVELDRKAEF--NDHVAAVCLPPD 239

  Fly   265 RGRYANQLAGSAADVSGWGKTESSGSSKIKQKAMLHIQPQDQCQE--AFYKDTKITLADSQMCAG 327
            .|....|:.     .:|||.|.....|....|..|.....:.||:  .|..||:     :|.|||
  Fly   240 SGNDVQQVT-----AAGWGFTADGVKSSHLLKVNLQRFSDEVCQKRLRFSIDTR-----TQFCAG 294

  Fly   328 G-EIGVDSCSGDSGGPLTVEANTASGNRYVY-----LAGVVSIGRKHCGTALFSGIYTRVSSYMD 386
            . ....|:|:||||||:.|:       ..:|     :.|:||.|.. ||:.....:||:|..|.|
  Fly   295 SMSSQADTCNGDSGGPIFVQ-------HPLYPCLKQVIGIVSYGLV-CGSQGLPSVYTKVHLYTD 351

  Fly   387 WIESTIRAN 395
            ||||.:..|
  Fly   352 WIESIVWGN 360

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser7NP_572582.1 CLIP 29..74 CDD:197829 12/42 (29%)
Tryp_SPc 131..388 CDD:214473 80/280 (29%)
Tryp_SPc 133..391 CDD:238113 83/281 (30%)
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 83/282 (29%)
Tryp_SPc 102..353 CDD:214473 80/279 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455928
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24258
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.