DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser7 and CG13527

DIOPT Version :9

Sequence 1:NP_572582.1 Gene:Ser7 / 31917 FlyBaseID:FBgn0019929 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_001286744.1 Gene:CG13527 / 37615 FlyBaseID:FBgn0034776 Length:292 Species:Drosophila melanogaster


Alignment Length:256 Identity:63/256 - (24%)
Similarity:97/256 - (37%) Gaps:67/256 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   157 GKDYACGASFIAQRWLLTAAHCIHTMGRNLTAA-----ILGEWNRDTDPDCENDLNGVRECAPPH 216
            |.::.||...::.:|::|||||:....:.:..|     :.|      .|.......|...|:|  
  Fly    57 GDNHYCGGGLLSNQWVITAAHCVMGQSKIMYKARWLLVVAG------SPHRLRYTPGKSVCSP-- 113

  Fly   217 IRVTIDRILPHAQYSELNYRNDIALLRLSRPVNWLQMQNLEP----VCLPPQRGRYANQLAGSAA 277
                :..:.....::..|..| :||::|..     :|.:.:|    :.||.:..:     .|...
  Fly   114 ----VSSLYVPKNFTMHNTFN-MALMKLQE-----KMPSNDPRIGFLHLPKEAPK-----IGIRH 163

  Fly   278 DVSGWGKTESSGSSKIKQKAMLHIQPQD-------QCQEAFYKDTKITLADSQMCAGGE---IGV 332
            .|.|||:....|...:      ||...|       .|:..|..     ..|..||||..   |..
  Fly   164 TVLGWGRMYFGGPLAV------HIYQVDVVLMDNAVCKTYFRH-----YGDGMMCAGNNNWTIDA 217

  Fly   333 DSCSGDSGGPLTVEANTASGNRYVYLAGVVS--IGRKHCGTALFSGIYTRVSSYMDWIEST 391
            :.||||.|.||      .||.   .:.|:|:  ||   ||......:||.|.|.:.||..|
  Fly   218 EPCSGDIGSPL------LSGK---VVVGIVAYPIG---CGCTNIPSVYTDVFSGLRWIRHT 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser7NP_572582.1 CLIP 29..74 CDD:197829
Tryp_SPc 131..388 CDD:214473 60/251 (24%)
Tryp_SPc 133..391 CDD:238113 62/254 (24%)
CG13527NP_001286744.1 Tryp_SPc 43..266 CDD:238113 62/254 (24%)
Tryp_SPc 43..263 CDD:214473 60/251 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455945
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.