DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser7 and tpr

DIOPT Version :9

Sequence 1:NP_572582.1 Gene:Ser7 / 31917 FlyBaseID:FBgn0019929 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_611611.1 Gene:tpr / 37486 FlyBaseID:FBgn0034661 Length:372 Species:Drosophila melanogaster


Alignment Length:328 Identity:114/328 - (34%)
Similarity:169/328 - (51%) Gaps:57/328 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 TNIIPPLAPRISNGTTNATSSTTTLKLLPRTTPRPPSGIDQLPEHP-------YCGSA-FSFRLV 133
            ::::|..|...|..|...:|||||.:  ..|||.||:      .:|       .||.| ...|:|
  Fly    72 SSMMPDAASTTSTTTPAPSSSTTTTR--RATTPAPPT------LNPPRNCSDCVCGIANIQKRIV 128

  Fly   134 GGHNTGLFEFPWTTLLEYETVSGGKDYACGASFIAQRWLLTAAHCIHTMGRNLTAAILGEWNRDT 198
            ||..|.:.::||..:|.|    ||:.| |.||.:..::||||:||::...:...:..|.|.:|..
  Fly   129 GGQETEVHQYPWVAMLLY----GGRFY-CAASLLNDQFLLTASHCVYGFRKERISVRLLEHDRKM 188

  Fly   199 DPDCENDLNGVRECAPPHIRVTIDR----ILPHAQYSELNYRNDIALLRLSRPVNWLQMQNLEPV 259
            .                |:: .|||    ::.|.:|:..||.||||:::|..||.:.::  |.||
  Fly   189 S----------------HMQ-KIDRKVAEVITHPKYNARNYDNDIAIIKLDEPVEFNEV--LHPV 234

  Fly   260 CLPPQRGRYANQLAGSAADVSGWGKTESSG-SSKIKQKAMLHIQPQDQCQEAFYKDTKITLADSQ 323
            |:|.. ||   ...|....|:|||..:..| :|...|:..:.|..||:|:::.| ..|||  |:.
  Fly   235 CMPTP-GR---SFKGENGIVTGWGALKVGGPTSDTLQEVQVPILSQDECRKSRY-GNKIT--DNM 292

  Fly   324 MCAG-GEIGVDSCSGDSGGPLTVEANTASGNRYVYLAGVVSIGRKHCGTALFSGIYTRVSSYMDW 387
            :|.| .|.|.|||.|||||||.:   .|||.|...:|||||.| :.|..|.:.|:|.||:.|..|
  Fly   293 LCGGYDEGGKDSCQGDSGGPLHI---VASGTREHQIAGVVSWG-EGCAKAGYPGVYARVNRYGTW 353

  Fly   388 IES 390
            |::
  Fly   354 IKN 356

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser7NP_572582.1 CLIP 29..74 CDD:197829
Tryp_SPc 131..388 CDD:214473 94/262 (36%)
Tryp_SPc 133..391 CDD:238113 95/264 (36%)
tprNP_611611.1 Tryp_SPc 126..354 CDD:214473 94/262 (36%)
Tryp_SPc 127..356 CDD:238113 95/263 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.