DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser7 and CG11192

DIOPT Version :9

Sequence 1:NP_572582.1 Gene:Ser7 / 31917 FlyBaseID:FBgn0019929 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_611479.2 Gene:CG11192 / 37309 FlyBaseID:FBgn0034507 Length:279 Species:Drosophila melanogaster


Alignment Length:310 Identity:86/310 - (27%)
Similarity:129/310 - (41%) Gaps:87/310 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   108 TPRPPSGIDQLPEHPYCGSAFSFRLVGGHNTGLFEFPWTTLLEYETVSGGKDYACGASFIAQRWL 172
            ||.|..|                |:|||....:.|||:...::.:    |: :.||.:.|....:
  Fly    20 TPTPGDG----------------RIVGGEVATIQEFPYQVSVQLQ----GR-HICGGAIIGIDTV 63

  Fly   173 LTAAHCIHTMGRNLTAAILGEWNRDTDP-----------DCENDLNGVRECAPPHIRVTIDRILP 226
            ||||||..                  ||           ..|::..|       |: :::.|::.
  Fly    64 LTAAHCFE------------------DPWSSADYTVRVGSSEHESGG-------HV-LSLRRVIA 102

  Fly   227 HAQYSELNYRNDIALLRLSRPVNWLQMQNLEPVCL-----PPQRGRYANQLAGSAADVSGWG--K 284
            |..|:..::.||:|||.|:..:|:  .::|:||.|     ||        .|.:...|||||  .
  Fly   103 HGDYNPQSHDNDLALLILNGQLNF--TEHLQPVPLAALADPP--------TADTRLQVSGWGFQA 157

  Fly   285 TESSGSSKIKQKAMLHIQPQD-----QCQEAFYKDTKITLADSQMCAGGEIGVDSCSGDSGGPLT 344
            .||:.|.::.....|.....|     ||:.|:.:...||   .:|......|.|||.|||||||.
  Fly   158 EESAVSGEVGVSPQLRFVDVDLVESNQCRRAYSQVLPIT---RRMICAARPGRDSCQGDSGGPLV 219

  Fly   345 VEANTASGNRYVYLAGVVSIGRKHCGTALFSGIYTRVSSYMDWIESTIRA 394
            ..|......|   |.|:||.| ..|....|.|:||.|:::..||:..:.|
  Fly   220 GYAAEEGPAR---LYGIVSWG-LGCANPNFPGVYTNVAAFRSWIDEQLDA 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser7NP_572582.1 CLIP 29..74 CDD:197829
Tryp_SPc 131..388 CDD:214473 79/279 (28%)
Tryp_SPc 133..391 CDD:238113 80/280 (29%)
CG11192NP_611479.2 Tryp_SPc 27..259 CDD:214473 79/279 (28%)
Tryp_SPc 28..262 CDD:238113 80/281 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.