DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser7 and CG10764

DIOPT Version :9

Sequence 1:NP_572582.1 Gene:Ser7 / 31917 FlyBaseID:FBgn0019929 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_611213.2 Gene:CG10764 / 36962 FlyBaseID:FBgn0034221 Length:523 Species:Drosophila melanogaster


Alignment Length:279 Identity:80/279 - (28%)
Similarity:121/279 - (43%) Gaps:48/279 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   124 CGSAFSFRLVGGHNTGLFEFPWTTLLEYETVSGGKDYACGASFIAQRWLLTAAHCIHTMGRNLTA 188
            ||.:...::.||.:.......|..     .:....|:.||.:.|..|::|:||||: ..|.:|..
  Fly    30 CGISTRPKISGGDDAAEPNSIWMA-----AIFNSSDFQCGGTIIHMRFVLSAAHCL-VRGYDLYV 88

  Fly   189 AILGEWNRDTDPDCENDLNGVRECAPPHIRVTIDRILPHAQYSELNYRNDIALLRLSRPVNWLQM 253
            .:                 |.|....|....|:..:..|..:....|||||.||:||..:  :..
  Fly    89 RL-----------------GARNINEPAAVHTVINVFVHHDFIASEYRNDIGLLQLSESI--VYT 134

  Fly   254 QNLEPVC--LPPQRGRYANQLAGSAADVS-----GWGKTESSGSSKIKQKAMLHIQPQDQCQEAF 311
            ..::|:|  |.|       .|.||...:.     |||......|..::...:||:: :::|:   
  Fly   135 VRVQPICIFLDP-------ALKGSVEKLKTFRALGWGNRNGKLSIMLQTIYLLHLK-RNECK--- 188

  Fly   312 YKDTKITLADSQMCAGGEIGVDSCSGDSGGPLTVEANTASGNRYVYLAGVVSIGRKHCGTALFSG 376
             :.....|...|:|||.:.| |:|.|||||||:......|...|....|:||.|...|...   |
  Fly   189 -RKLNFNLNSRQICAGTKNG-DTCRGDSGGPLSTNILFPSNKSYEVQLGIVSFGDPECRGV---G 248

  Fly   377 IYTRVSSYMDWIESTIRAN 395
            :||.|:||:|||.|||..|
  Fly   249 VYTDVTSYVDWISSTIARN 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser7NP_572582.1 CLIP 29..74 CDD:197829
Tryp_SPc 131..388 CDD:214473 72/263 (27%)
Tryp_SPc 133..391 CDD:238113 74/264 (28%)
CG10764NP_611213.2 Tryp_SPc 37..260 CDD:214473 72/263 (27%)
Tryp_SPc 38..263 CDD:238113 74/265 (28%)
Tryp_SPc 317..512 CDD:214473
Tryp_SPc 317..512 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.