DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser7 and Tmprss4

DIOPT Version :9

Sequence 1:NP_572582.1 Gene:Ser7 / 31917 FlyBaseID:FBgn0019929 Length:397 Species:Drosophila melanogaster
Sequence 2:XP_038937788.1 Gene:Tmprss4 / 367074 RGDID:1305033 Length:478 Species:Rattus norvegicus


Alignment Length:398 Identity:95/398 - (23%)
Similarity:165/398 - (41%) Gaps:113/398 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 VEFGRGT----CIEKKDCDFYAVDKLMELASKQQCFSRQRP--DLVCCPRETNIIPPLAP----- 85
            ::..|||    |.:.      ..:.|.:.|.:|..::.|..  .:...|.:|.::.|:..     
  Rat   157 LDAARGTWASVCFDN------FTEALAKTACRQMGYNSQPAFGPVEMGPNQTLLVTPVTGNSQEL 215

  Fly    86 RISNGTTNATS-STTTLKLLPRTTPRPPSGIDQLPEHPYCGSAF-SFRLVGGHNTGLFEFPWTTL 148
            ::.||:.:..| |..:|:.|.                  ||.:. :.|:|||.......:||...
  Rat   216 QMQNGSRSCLSGSLVSLRCLD------------------CGKSLKTTRVVGGVEASADSWPWQVS 262

  Fly   149 LEYETVSGGKDYACGASFIAQRWLLTAAHCIHTMGRNLTAAILGEWNRDTDPDCENDLNGVRECA 213
            ::|     .|.:.||.|.:...|:||||||....      ..:..|.                  
  Rat   263 IQY-----NKQHVCGGSILDHHWILTAAHCFRKY------LDVSSWK------------------ 298

  Fly   214 PPHIRVTIDRI-----LPHAQ--YSELN----YRNDIALLRLSRPVNWLQMQNLEPVCLPPQRGR 267
               :|...:::     ||.|:  .:|.|    ...||||::|..|:.:  ..::.|:|||     
  Rat   299 ---VRAGSNKLGNSPSLPVAKIFIAEPNPLQPKEKDIALVKLKMPLTF--SGSVRPICLP----- 353

  Fly   268 YANQ--LAGSAADVSGWGKTESSGS--SKIKQKAMLHIQPQDQC--QEAFYKDTKITLADSQMCA 326
            ::::  :......|.|||.||.:|.  |....:|.:.:....:|  ::|:..:    :....:||
  Rat   354 FSDEELIPTMPVWVIGWGFTEENGGKMSDTLLQASVQVIDSARCNAEDAYQGE----VTAGMLCA 414

  Fly   327 G-GEIGVDSCSGDSGGPLTVEANTASGNRYVY----LAGVVSIGRKHCGTALFSGIYTRVSSYMD 386
            | .:.|.|:|.|||||||          .|.|    :.|:||.| ..||:....|:||:|::|:|
  Rat   415 GTPQGGKDTCQGDSGGPL----------MYHYDKWQVVGIVSWG-YGCGSPSTPGVYTKVTAYLD 468

  Fly   387 WIESTIRA 394
            ||.:..|:
  Rat   469 WIYNVRRS 476

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser7NP_572582.1 CLIP 29..74 CDD:197829 8/47 (17%)
Tryp_SPc 131..388 CDD:214473 73/278 (26%)
Tryp_SPc 133..391 CDD:238113 74/279 (27%)
Tmprss4XP_038937788.1 LDLa 99..133 CDD:238060
SRCR_2 149..238 CDD:413346 17/104 (16%)
Tryp_SPc 245..470 CDD:214473 73/278 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.