DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser7 and Ser8

DIOPT Version :9

Sequence 1:NP_572582.1 Gene:Ser7 / 31917 FlyBaseID:FBgn0019929 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_610874.1 Gene:Ser8 / 36489 FlyBaseID:FBgn0019928 Length:260 Species:Drosophila melanogaster


Alignment Length:302 Identity:89/302 - (29%)
Similarity:126/302 - (41%) Gaps:67/302 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    99 TTLKLLPRTTPRP-PSGIDQLPEHPYCGSAFSFRLVGGHNTGLFEFPWTTLLEYETVSGGKDYAC 162
            |.|.||..|.... |.|::  |:    .|:...|:|||..:.:.:.||...|:.   ||  .:.|
  Fly     7 TFLALLALTNGAVIPIGLE--PQ----TSSLGGRIVGGTASSIEDRPWQVSLQR---SG--SHFC 60

  Fly   163 GASFIAQRWLLTAAHCIHTMGRNLTAAILGEWNRDTDPDCENDLNGVRECAPPHIRVTIDRILPH 227
            |.|.|:...::|||||:.|........|....|:.|       ..||        .|.:..|..|
  Fly    61 GGSIISNNIIVTAAHCLDTPTTVSNLRIRAGSNKRT-------YGGV--------LVEVAAIKAH 110

  Fly   228 AQYSELNYRNDIALLRLSRPVNW------LQMQNLEPVCLPPQRGRYANQLAGSAADVSGWGKTE 286
            ..|:..:..|||.::||...:.:      :.|.:..|.             .||||.:||||||.
  Fly   111 EAYNSNSKINDIGVVRLKTKLTFGSTIKAITMASATPA-------------HGSAASISGWGKTS 162

  Fly   287 SSGSSKIKQKAML-----HIQPQDQCQEAFYKDTKITLADSQMCAGGEIGVDSCSGDSGGPLTVE 346
            :.|.|    .|.|     .|..:.||..:.|.......| :.:||.. ...|:|.|||||||   
  Fly   163 TDGPS----SATLLFVDTRIVGRSQCGSSTYGYGSFIKA-TMICAAA-TNKDACQGDSGGPL--- 218

  Fly   347 ANTASGNRYVYLAGVVSIGRKHCGTALFSGIYTRVSSYMDWI 388
               .||.:   |.||||.|| .|..|.:.|:|..::...||:
  Fly   219 ---VSGGQ---LVGVVSWGR-DCAVANYPGVYANIAELRDWV 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser7NP_572582.1 CLIP 29..74 CDD:197829
Tryp_SPc 131..388 CDD:214473 79/267 (30%)
Tryp_SPc 133..391 CDD:238113 79/267 (30%)
Ser8NP_610874.1 Tryp_SPc 34..253 CDD:214473 79/267 (30%)
Tryp_SPc 35..253 CDD:238113 78/266 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.