DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser7 and iotaTry

DIOPT Version :9

Sequence 1:NP_572582.1 Gene:Ser7 / 31917 FlyBaseID:FBgn0019929 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_523695.1 Gene:iotaTry / 36223 FlyBaseID:FBgn0015001 Length:252 Species:Drosophila melanogaster


Alignment Length:265 Identity:65/265 - (24%)
Similarity:105/265 - (39%) Gaps:41/265 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   131 RLVGGHNTGLFEFPWTTLLEYETVSGGKDYACGASFIAQRWLLTAAHCIHTMGRNLTAAILGEWN 195
            |::||.:..:...||...::...     .:.||....::..::||.||:|.....|....:|..|
  Fly    27 RIIGGSDQLIRNAPWQVSIQISA-----RHECGGVIYSKEIIITAGHCLHERSVTLMKVRVGAQN 86

  Fly   196 RDTDPDCENDLNGVRECAPPHIRVTIDRILPHAQYSELNYRNDIALLRLSRPVNW-LQMQNLEPV 259
                    ::..|.        .|.:.....|.|:.......|||:||||.|:.: |..:.:...
  Fly    87 --------HNYGGT--------LVPVAAYKVHEQFDSRFLHYDIAVLRLSTPLTFGLSTRAINLA 135

  Fly   260 CLPPQRGRYANQLAGSAADVSGWGKTESSGSSKIKQKAMLHIQPQDQCQEAFYKDTKITLADSQM 324
            ...|.        .|:...|:|||.|::...|...|||.|.|..:.:|....:......:.:..:
  Fly   136 STSPS--------GGTTVTVTGWGHTDNGALSDSLQKAQLQIIDRGECASQKFGYGADFVGEETI 192

  Fly   325 CAGGEIGVDSCSGDSGGPLTVEANTASGNRYVYLAGVVSIGRKHCGTALFSGIYTRVSSYMDWIE 389
            || .....|:|:|||||||...:.         |.|:||.|.: |....:.|:|..|:....||.
  Fly   193 CA-ASTDADACTGDSGGPLVASSQ---------LVGIVSWGYR-CADDNYPGVYADVAILRPWIV 246

  Fly   390 STIRA 394
            ....|
  Fly   247 KAANA 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser7NP_572582.1 CLIP 29..74 CDD:197829
Tryp_SPc 131..388 CDD:214473 62/257 (24%)
Tryp_SPc 133..391 CDD:238113 63/258 (24%)
iotaTryNP_523695.1 Tryp_SPc 27..245 CDD:214473 62/257 (24%)
Tryp_SPc 28..247 CDD:238113 63/258 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.