DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser7 and zetaTry

DIOPT Version :9

Sequence 1:NP_572582.1 Gene:Ser7 / 31917 FlyBaseID:FBgn0019929 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_523691.1 Gene:zetaTry / 36216 FlyBaseID:FBgn0011556 Length:280 Species:Drosophila melanogaster


Alignment Length:276 Identity:76/276 - (27%)
Similarity:126/276 - (45%) Gaps:50/276 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   131 RLVGGHNTGLFEFPWTTLLEYETVSGGKD---YACGASFIAQRWLLTAAHCIHTMGRNLTAA--- 189
            |:|||:.|.:.:.|:...|.|:.::..::   :.||.|...:..::|||||:  :|   |.|   
  Fly    38 RIVGGYATDIAQVPYQISLRYKGITTPENPFRHRCGGSIFNETTIVTAAHCV--IG---TVASQY 97

  Fly   190 -ILGEWNRDTDPDCENDLNGVRECAPPHIRVTIDRILPHAQYSELNYRNDIALLRLSRPVNWLQM 253
             ::...|..|..|  ..:..|:|.           ::....||...|.||||:|.:..|   |.:
  Fly    98 KVVAGTNFQTGSD--GVITNVKEI-----------VMHEGYYSGAAYNNDIAILFVDPP---LPL 146

  Fly   254 QN--LEPVCLPPQRGRYANQLAGSAADVSGWGKTESSGSSKIKQKAM-LHIQPQDQCQEAF--YK 313
            .|  ::.:.|..::     .:.|:.:.|||||.|...|.|..:..|: :.|...:.|.:.:  :.
  Fly   147 NNFTIKAIKLALEQ-----PIEGTVSKVSGWGTTSPGGYSSNQLLAVDVPIVSNELCDQDYEDFG 206

  Fly   314 DTKITLADSQMCAG--GEIGVDSCSGDSGGPLTVEANTASGNRYVYLAGVVSIGRKHCGTALFSG 376
            |....:..:.:|||  |..|.|:|.|||||||.|...         |.||||.|.. |....:.|
  Fly   207 DETYRITSAMLCAGKRGVGGADACQGDSGGPLAVRDE---------LYGVVSWGNS-CALPNYPG 261

  Fly   377 IYTRVSSYMDWIESTI 392
            :|..|:....||::.:
  Fly   262 VYANVAYLRPWIDAVL 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser7NP_572582.1 CLIP 29..74 CDD:197829
Tryp_SPc 131..388 CDD:214473 74/270 (27%)
Tryp_SPc 133..391 CDD:238113 75/271 (28%)
zetaTryNP_523691.1 Tryp_SPc 38..273 CDD:214473 74/270 (27%)
Tryp_SPc 39..276 CDD:238113 75/272 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.