DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser7 and lambdaTry

DIOPT Version :9

Sequence 1:NP_572582.1 Gene:Ser7 / 31917 FlyBaseID:FBgn0019929 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_610673.1 Gene:lambdaTry / 36214 FlyBaseID:FBgn0043470 Length:272 Species:Drosophila melanogaster


Alignment Length:270 Identity:78/270 - (28%)
Similarity:122/270 - (45%) Gaps:52/270 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   131 RLVGGHNTGLFEFPWTTLLEYETVSGGKDYACGASFIAQRWLLTAAHCIHTMG--RNLTAAILGE 193
            |:|||.:|.:.::|....:.|.     .::.||.:......:::||||::|:.  .||| .:.|.
  Fly    35 RIVGGQDTNITQYPHQISMRYR-----GNHRCGGTIYRSNQIISAAHCVNTLSGPENLT-IVAGS 93

  Fly   194 WN--RDTDPDCENDLNGVRECAPPHIRVTIDRILPHAQYSELNYRNDIALLRLSRPVNWLQMQNL 256
            .|  ..|.|..|.:   |||            |:.|.:|..||...|.|:|.|.....:  ...:
  Fly    94 SNIWFPTGPQQELE---VRE------------IIIHPKYRTLNNDYDAAILILDGDFEF--NDAV 141

  Fly   257 EPVCLPPQRGRYANQLAGSAADVSGWGKTESSGS-SKIKQKAMLHIQPQDQCQEAFYKDTKITLA 320
            :|:.|..:|..:     .:...|:|||.|...|: |.:.|:..:::.....|:.|:    .|.|.
  Fly   142 QPIELAKERPDH-----DTPVTVTGWGTTSEGGTISDVLQEVSVNVVDNSNCKNAY----SIMLT 197

  Fly   321 DSQMCA---GGEIGVDSCSGDSGGPLTVEANTASGNRYVYLAGVVSIGRKHCGTALFSGIYTRVS 382
            ...:||   ||  |.|:|.||||||| |..||        |.|:||.| ..|....:.|:|..|.
  Fly   198 SRMLCAGVNGG--GKDACQGDSGGPL-VYNNT--------LLGIVSWG-TGCAREKYPGVYCSVP 250

  Fly   383 SYMDWIESTI 392
            ..:||:..|:
  Fly   251 DVLDWLVETV 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser7NP_572582.1 CLIP 29..74 CDD:197829
Tryp_SPc 131..388 CDD:214473 76/264 (29%)
Tryp_SPc 133..391 CDD:238113 76/265 (29%)
lambdaTryNP_610673.1 Tryp_SPc 35..255 CDD:214473 75/263 (29%)
Tryp_SPc 36..259 CDD:238113 76/266 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.