DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser7 and CG12133

DIOPT Version :9

Sequence 1:NP_572582.1 Gene:Ser7 / 31917 FlyBaseID:FBgn0019929 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_610540.2 Gene:CG12133 / 36036 FlyBaseID:FBgn0033469 Length:340 Species:Drosophila melanogaster


Alignment Length:283 Identity:96/283 - (33%)
Similarity:138/283 - (48%) Gaps:12/283 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   116 DQLPEHPYCG-SAFSFRLVGGHNTGLFEFPWTTLLEYE--TVSGGKDYACGASFIAQRWLLTAAH 177
            |:||:...|| |..|..:|||......:||||.||.||  |........|..|.||.|::|||||
  Fly    45 DKLPDSRVCGQSPPSSYIVGGMEAQSNQFPWTVLLGYEAYTAKQRPSPMCAGSLIASRYVLTAAH 109

  Fly   178 CIHTMGRNLTAAILGEWNRDTDPDCENDLNGVRECAPPHIRVTIDRILPHAQYSELNYR--NDIA 240
            |::.....:....|||.:.:.|||.....||.:..||.|:.:.:|..:||.||...|.|  ||||
  Fly   110 CLNVNDFYVARVRLGEHDTENDPDYTWLPNGAKIWAPAHVDIDVDLRVPHEQYYTRNGRHYNDIA 174

  Fly   241 LLRLSRPVNW-LQMQNLEPVCLPPQRGRYANQLAGSAADVSGWGKTESSGSSKIKQKAMLHIQPQ 304
            ||||...|.: ||   :.|:|:.|......:........::|||.:.....|.:.::..:.....
  Fly   175 LLRLKSRVKYTLQ---IRPICIWPGIELSTSSFKNFPFQIAGWGDSGLQQKSTVLRQGTISGMSP 236

  Fly   305 DQCQEAFYKDTKITLADSQMCAGGEIGVDSCSGDSGGPLTVEANTASGNRYVYLAGVVSIGRKHC 369
            |:|...:  .|.:...|.|:||.|..|.|:..||||.||.......: :::.||||:.|.|....
  Fly   237 DECLNRY--PTLLVDKDIQICAMGWDGTDTGLGDSGSPLMASVGRGA-DQFYYLAGITSYGGGPS 298

  Fly   370 GTALFSGIYTRVSSYMDWIESTI 392
            .......:||:.|||.:||:..|
  Fly   299 SYGYGPAVYTKTSSYYEWIKKKI 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser7NP_572582.1 CLIP 29..74 CDD:197829
Tryp_SPc 131..388 CDD:214473 86/261 (33%)
Tryp_SPc 133..391 CDD:238113 88/262 (34%)
CG12133NP_610540.2 Tryp_SPc 62..320 CDD:238113 88/263 (33%)
Tryp_SPc 62..317 CDD:214473 86/260 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 130 1.000 Domainoid score I5140
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D85090at50557
OrthoFinder 1 1.000 - - FOG0003849
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.