DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser7 and CG8170

DIOPT Version :9

Sequence 1:NP_572582.1 Gene:Ser7 / 31917 FlyBaseID:FBgn0019929 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_610441.2 Gene:CG8170 / 35908 FlyBaseID:FBgn0033365 Length:855 Species:Drosophila melanogaster


Alignment Length:337 Identity:90/337 - (26%)
Similarity:150/337 - (44%) Gaps:63/337 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 CCPRETNIIPPLAPRISNGTTNATSSTTTLKLLPRTTPRPPSGIDQLPEHPYCGSAFS-----FR 131
            ||.|       .|...:.|:::...:...|..||:....|      :...|.||.:.:     .|
  Fly   560 CCHR-------TAKSANLGSSDFVGNAVDLTDLPQKNYGP------VNNEPSCGISLAKQTAQRR 611

  Fly   132 LVGGHNTGLFEFPWTTLLEYETVSGGKDYACGASFIAQRWLLTAAHCIHTMGRNLTAAILGEWNR 196
            :|||.:.|...|||..   |..:...:   ||.|.|::|.::||.||:...........||::  
  Fly   612 IVGGDDAGFGSFPWQA---YIRIGSSR---CGGSLISRRHVVTAGHCVARATPRQVHVTLGDY-- 668

  Fly   197 DTDPDCENDLNGVRECAPPH---IRVTIDRILPHAQYSELNYRNDIALLRLSRPVNWLQMQNLEP 258
                    .:|...|..|.:   :| .|| :.|:.:::....|.||::|.|.|.|::  |.::.|
  Fly   669 --------VINSAVEPLPAYTFGVR-RID-VHPYFKFTPQADRFDISVLTLERTVHF--MPHIAP 721

  Fly   259 VCLPPQRGRYANQLAGSAADVSGWGKTESSGSSKIKQKAMLHIQP---QDQCQEAFYKDT--KIT 318
            :|||.:...:..:...:|    |||..  :..|:::.|.:..:..   :::..|.:::..  .:.
  Fly   722 ICLPEKNEDFLGKFGWAA----GWGAL--NPGSRLRPKTLQAVDVPVIENRICERWHRQNGINVV 780

  Fly   319 LADSQMCAG---GEIGVDSCSGDSGGPLTVEANTASGNRYVYLAGVVSIGRKHCGTALFSGIYTR 380
            :....:|||   |  |.|||.|||||||..:.|    .|: ||.||||.|.. |.:....|||..
  Fly   781 IYQEMLCAGYRNG--GKDSCQGDSGGPLMHDKN----GRW-YLIGVVSAGYS-CASRGQPGIYHS 837

  Fly   381 VSSYMDWIESTI 392
            ||..:||:...:
  Fly   838 VSKTVDWVSYVV 849

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser7NP_572582.1 CLIP 29..74 CDD:197829 1/1 (100%)
Tryp_SPc 131..388 CDD:214473 77/267 (29%)
Tryp_SPc 133..391 CDD:238113 77/268 (29%)
CG8170NP_610441.2 Tryp_SPc 611..845 CDD:214473 77/267 (29%)
Tryp_SPc 612..846 CDD:238113 77/267 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.