DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser7 and CG8172

DIOPT Version :9

Sequence 1:NP_572582.1 Gene:Ser7 / 31917 FlyBaseID:FBgn0019929 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_001097235.2 Gene:CG8172 / 35905 FlyBaseID:FBgn0033362 Length:561 Species:Drosophila melanogaster


Alignment Length:285 Identity:99/285 - (34%)
Similarity:144/285 - (50%) Gaps:41/285 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   122 PYCGSAF--SFRLVGGHNTGLFEFPWTTLLEYETVSGG---KDYACGASFIAQRWLLTAAHCIHT 181
            |.||..:  |.|:||||:||....||...|    :..|   :..:||.:.|:.||::|||||:.:
  Fly   304 PGCGEVYTRSNRIVGGHSTGFGSHPWQVAL----IKSGFLTRKLSCGGALISNRWVITAAHCVAS 364

  Fly   182 MGRNLTAAILGEWNRDTDPDCENDLNGVRECAPPHIRVTIDRILPHAQYSELNYRNDIALLRLSR 246
            ...:.....||||          |:.|..| ...|....|:|...|..|:..::.||:||:||.|
  Fly   365 TPNSNMKIRLGEW----------DVRGQEE-RLNHEEYGIERKEVHPHYNPADFVNDVALIRLDR 418

  Fly   247 PVNWLQMQNLEPVCLPPQRGRYANQLAGSAADVSGWGKTESSGSS--KIKQKAMLHIQPQDQCQE 309
              |.:..|::.||||||.    ..:|.|..|.|:|||:|....|:  .:.|:..:.:...|:||.
  Fly   419 --NVVYKQHIIPVCLPPS----TTKLTGKMATVAGWGRTRHGQSTVPSVLQEVDVEVISNDRCQR 477

  Fly   310 AF-YKDTKITLADSQMCAG-GEIGVDSCSGDSGGPLTVEANTASGNRYVYLAGVVS--IGRKHCG 370
            .| ....:..:.|..:||| .:.|.|||.||||||||:   |..|.:  .|.|:||  ||   ||
  Fly   478 WFRAAGRREAIHDVFLCAGYKDGGRDSCQGDSGGPLTL---TMDGRK--TLIGLVSWGIG---CG 534

  Fly   371 TALFSGIYTRVSSYMDWIESTIRAN 395
            .....|:||.:..::.|| :.:.||
  Fly   535 REHLPGVYTNIQRFVPWI-NKVMAN 558

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser7NP_572582.1 CLIP 29..74 CDD:197829
Tryp_SPc 131..388 CDD:214473 91/265 (34%)
Tryp_SPc 133..391 CDD:238113 92/266 (35%)
CG8172NP_001097235.2 Tryp_SPc 315..552 CDD:214473 91/265 (34%)
Tryp_SPc 316..555 CDD:238113 92/268 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.