DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser7 and Np

DIOPT Version :9

Sequence 1:NP_572582.1 Gene:Ser7 / 31917 FlyBaseID:FBgn0019929 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_001246213.1 Gene:Np / 35904 FlyBaseID:FBgn0265011 Length:1041 Species:Drosophila melanogaster


Alignment Length:365 Identity:105/365 - (28%)
Similarity:163/365 - (44%) Gaps:64/365 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 MELASKQQCFSRQRPDLVCCPRETNIIPPLAPRISNGTTNATSS----------------TTTLK 102
            :||||....:             |::...||...|:.||..|||                |||::
  Fly   715 IELASSTSSY-------------TDLGSDLAASSSSSTTTTTSSPTTAAETTDYSGEEPNTTTIE 766

  Fly   103 LLPRTTPRPPSGIDQLPEHPYCGSAF--SFRLVGGHNTGLFEFPW-TTLLEYETVSGGKDYACGA 164
            ....||..|.:.::.:.....||...  ..|:|||.|.....:|| .:|.::.|.:  ..:.|||
  Fly   767 ATGSTTVAPANALEGVDYKEVCGRRMFPEPRIVGGANAAFGRWPWQISLRQWRTST--YLHKCGA 829

  Fly   165 SFIAQRWLLTAAHCIHTMGRNLTAAILGEWNRDTDPDCENDLNGVRECAPPHIRVTIDRILPHAQ 229
            :.:.:.|.:|||||:..:..:.....|||:    |...|.:..|.:|     .||.|  :..|.|
  Fly   830 ALLNENWAITAAHCVDNVPPSDLLLRLGEY----DLAEEEEPYGYQE-----RRVQI--VASHPQ 883

  Fly   230 YSELNYRNDIALLRLSRPVNWLQMQNLEPVCLPPQRGRYANQLAGSAADVSGWGKTESSGS-SKI 293
            :....:..|:||||...||  :...|:.|||:|.....:    .|..|.|:|||:....|. ..:
  Fly   884 FDPRTFEYDLALLRFYEPV--IFQPNIIPVCVPDNDENF----IGQTAFVTGWGRLYEDGPLPSV 942

  Fly   294 KQKAMLHIQPQDQCQEAFYKDTKIT--LADSQMCAGGEI-GVDSCSGDSGGPLTVEANTASGNRY 355
            .|:..:.:.....| |:.|:.....  :....:|||.:. |.|||.||||||:.::..  |..|:
  Fly   943 LQEVAVPVINNTIC-ESMYRSAGYIEHIPHIFICAGWKKGGYDSCEGDSGGPMVLQRE--SDKRF 1004

  Fly   356 VYLAGVVS--IGRKHCGTALFSGIYTRVSSYMDWIESTIR 393
             :|.||:|  ||   |..|...|:|||:|.:.|||...::
  Fly  1005 -HLGGVISWGIG---CAEANQPGVYTRISEFRDWINQILQ 1040

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser7NP_572582.1 CLIP 29..74 CDD:197829 4/19 (21%)
Tryp_SPc 131..388 CDD:214473 82/263 (31%)
Tryp_SPc 133..391 CDD:238113 83/264 (31%)
NpNP_001246213.1 Tryp_SPc 797..1035 CDD:214473 82/263 (31%)
Tryp_SPc 798..1038 CDD:238113 83/265 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.