DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser7 and CG8586

DIOPT Version :9

Sequence 1:NP_572582.1 Gene:Ser7 / 31917 FlyBaseID:FBgn0019929 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_001286204.1 Gene:CG8586 / 35854 FlyBaseID:FBgn0033320 Length:444 Species:Drosophila melanogaster


Alignment Length:413 Identity:109/413 - (26%)
Similarity:168/413 - (40%) Gaps:100/413 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 CIEKKDCDFY-----------------AVDKLMELASKQQCFSRQRPDLVCCPRE---TNIIPPL 83
            |.||...|.|                 .|..::|....:.|    ..::.|.||:   .|||...
  Fly    65 CCEKAQLDSYDRWLVERTTTVPSTIRNKVSSVLEPPPNESC----GQNMECVPRKLCRDNIINDS 125

  Fly    84 APRISNGTTNATSSTTTLKLLPRTTPRPPS-------GIDQL---PEHPYC--GSAFSFRLVGGH 136
            ...:.|               ||.:|...|       .:||.   .|.||.  .:.|.::..|..
  Fly   126 GISLIN---------------PRISPIQCSKSLYRCCAVDQKVDDSESPYLVKQANFKYKNCGYS 175

  Fly   137 N-TGLF----------------EFPWTTLLEYETVSGGKDYACGASFIAQRWLLTAAHCIHTMGR 184
            | .||.                ||||...:    .:|.:::.||.:.|..|.::|.:|.:.....
  Fly   176 NPKGLIPDNDKFPYSEDVSIFGEFPWMVGI----FTGRQEFLCGGTLIHPRLVVTTSHNLVNETV 236

  Fly   185 NLTAAILGEWNRDTDPDCENDLNGVRECAP-PHIRVTIDRILPHAQYSELNYRNDIALLRLSRPV 248
            :...|..|:|          |||.:.|  | ||....|..|:.|:::...:..||||||.|..|:
  Fly   237 DTLVARAGDW----------DLNSLNE--PYPHQGSRIKEIIMHSEFDPNSLYNDIALLLLDEPI 289

  Fly   249 NWLQMQNLEPVCL-PPQRGRYANQLAGSAADVSGWGKTESSGSSKIK---QKAMLHIQPQDQCQE 309
            .  ...:::|:|| ||:.....|||.......:||| |:.:||.|::   ::..|.:..:::|| 
  Fly   290 R--LAPHIQPLCLPPPESPELTNQLLSVTCYATGWG-TKEAGSDKLEHVLKRINLPLVEREECQ- 350

  Fly   310 AFYKDTKI----TLADSQMCAGGEIGVDSCSGDSGGPLTVEANTASGNRYVYLAGVVSIGRKHCG 370
            |..::|::    .|..|.:||||:.|.|:|.||.|.||..:. ....:|| .|.|:||.| ..|.
  Fly   351 AKLRNTRLEARFRLRPSFICAGGDPGKDTCKGDGGSPLFCQM-PGEMDRY-QLVGIVSWG-VECA 412

  Fly   371 TALFSGIYTRVSSYMDWIESTIR 393
            ......:|..|.....||:..||
  Fly   413 VEDIPAVYVNVPHLRGWIDEKIR 435

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser7NP_572582.1 CLIP 29..74 CDD:197829 9/51 (18%)
Tryp_SPc 131..388 CDD:214473 80/282 (28%)
Tryp_SPc 133..391 CDD:238113 82/283 (29%)
CG8586NP_001286204.1 Tryp_SPc 197..433 CDD:238113 78/258 (30%)
Tryp_SPc 197..430 CDD:214473 76/255 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.