DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser7 and Jon44E

DIOPT Version :9

Sequence 1:NP_572582.1 Gene:Ser7 / 31917 FlyBaseID:FBgn0019929 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_001286203.1 Gene:Jon44E / 35853 FlyBaseID:FBgn0001285 Length:271 Species:Drosophila melanogaster


Alignment Length:271 Identity:84/271 - (30%)
Similarity:113/271 - (41%) Gaps:60/271 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   131 RLVGGHNTGLFEFPWTTLLEYETVSGGKDYACGASFIAQRWLLTAAHCIHTMGRNLT-------- 187
            |:..|:.....:.|:...|.:.  .||  |.||.|.|...|:||||||.::....|.        
  Fly    40 RITNGYPAYEGKIPYIVGLSFN--DGG--YWCGGSIIDHTWVLTAAHCTNSANHVLIYFGASFRH 100

  Fly   188 AAILGEWNRDTD----PDCENDLNGVRECAPPHIRVTIDRILPHAQYSELNYRNDIALLRLSRPV 248
            .|....|...:|    ||..:.||                             |||||:|:....
  Fly   101 EAQYTHWVSRSDMIQHPDWNDFLN-----------------------------NDIALIRIPHVD 136

  Fly   249 NWLQMQNLEPVCLPPQRGRYANQLAGSAADVSGWGKTE-SSGSSKIKQKAMLHIQPQDQCQEAFY 312
            .|..:..:|   ||....|| |..:|..|..||||.|: :||.|.......:.|...:.|:. :|
  Fly   137 FWSLVNKVE---LPSYNDRY-NSYSGWWAVASGWGLTDNNSGMSNYLNCVDVQIIDNNDCRN-YY 196

  Fly   313 KDTKITLADSQMCAGGEIGVDSCSGDSGGPLTVEANTASGNRYVYLAGVVSIGRKHCGTALFSGI 377
            ....||  |:.:|...:.|..||||||||||.:..|    ||.|   |:||.|.....||.....
  Fly   197 GSNYIT--DNTICINTDGGKSSCSGDSGGPLVLHDN----NRIV---GIVSFGSGEGCTAGRPAG 252

  Fly   378 YTRVSSYMDWI 388
            :|||:.|:|||
  Fly   253 FTRVTGYLDWI 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser7NP_572582.1 CLIP 29..74 CDD:197829
Tryp_SPc 131..388 CDD:214473 82/269 (30%)
Tryp_SPc 133..391 CDD:238113 83/269 (31%)
Jon44ENP_001286203.1 Tryp_SPc 40..263 CDD:214473 82/269 (30%)
Tryp_SPc 41..266 CDD:238113 83/270 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.