DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser7 and CG14760

DIOPT Version :9

Sequence 1:NP_572582.1 Gene:Ser7 / 31917 FlyBaseID:FBgn0019929 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_610366.1 Gene:CG14760 / 35802 FlyBaseID:FBgn0033277 Length:529 Species:Drosophila melanogaster


Alignment Length:330 Identity:94/330 - (28%)
Similarity:136/330 - (41%) Gaps:71/330 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    95 TSSTTTLK------LLPRTTPRPPSG---IDQLPE--HPYCGSAFSF--RLVGGHN--TGLFEFP 144
            :||.|:.|      ..|...|.|..|   ...|.|  .|.|...:|.  |:....|  ..|.|||
  Fly   225 SSSKTSAKRARIVSSYPTAAPSPGHGGGRFSCLVEAFQPTCSCGWSRIPRIASPTNEEAVLHEFP 289

  Fly   145 WTTLLEYETVSGGKDYACGASFIAQRWLLTAAHCIHTMGRNLTAA-----ILGEWNRDTDPDCEN 204
              .:....|...||.: |||:.|..|:||:||||.  :|....:|     ::|          |:
  Fly   290 --PMAGVLTKKHGKVF-CGAAIIHHRYLLSAAHCF--LGPETNSAAKLRVVVG----------EH 339

  Fly   205 DLNGVRECAPPHIRVTIDRILPHAQYSELN--YRNDIALLRLSRPVNWLQMQNLEPVCLPPQRGR 267
            ||....|..... |..:|.::.|..:|:.:  .:||||:|:....:.|  .|::.|.|||.|.|.
  Fly   340 DLASSFETFATQ-RYDLDALILHEDFSQASGQPKNDIAMLKTRMAIVW--SQHVGPACLPLQPGE 401

  Fly   268 YANQ--LAGSAADVSGWGKTESSGSSKIK-QKAMLHIQPQDQCQEAFYKDTKITLADSQMCAGG- 328
            ...:  |||.....:|||.|...|....: .||.|.:....:|::|.            ..||| 
  Fly   402 DGQKLPLAGHQVVAAGWGTTSYGGPQTHRLLKATLDVIDGRRCRQAL------------SSAGGL 454

  Fly   329 --------EIGVDSCSGDSGGPLTVEANTASGNRYVYLAGVVSIGRKHCGTALFSGIYTRVSSYM 385
                    ..|.|:|..||||.|....|..     :...|:||.|:. | .|....:.|||:|::
  Fly   455 PPHTFCTYTPGRDTCQYDSGGALYERINGR-----LMAVGIVSFGQA-C-AAQQPSVNTRVASFI 512

  Fly   386 DWIES 390
            .||.:
  Fly   513 KWIRT 517

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser7NP_572582.1 CLIP 29..74 CDD:197829
Tryp_SPc 131..388 CDD:214473 79/277 (29%)
Tryp_SPc 133..391 CDD:238113 80/279 (29%)
CG14760NP_610366.1 CUB 37..126 CDD:294042
Tryp_SPc 281..516 CDD:238113 78/271 (29%)
Tryp_SPc 281..515 CDD:214473 77/270 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455914
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24258
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.