DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser7 and CG17571

DIOPT Version :9

Sequence 1:NP_572582.1 Gene:Ser7 / 31917 FlyBaseID:FBgn0019929 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_001286096.1 Gene:CG17571 / 35409 FlyBaseID:FBgn0259998 Length:258 Species:Drosophila melanogaster


Alignment Length:274 Identity:76/274 - (27%)
Similarity:117/274 - (42%) Gaps:41/274 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   121 HPYCGSAFSF-RLVGGHNTGLFEFPWTTLLEYETVSGGKDYACGASFIAQRWLLTAAHCIHTMGR 184
            |...|..|.| |:|.|.:..:..:|:.  :..:|..|  .:.||.|.|....:||||||:.:...
  Fly    19 HGNPGLDFPFGRIVNGEDVDIENYPYQ--VSVQTTKG--SHFCGGSLIDSETVLTAAHCMQSYAA 79

  Fly   185 NLTAAILGEWNRDTDPDCENDLNGVRECAPPHIRVTIDRILPHAQYSELNYRNDIALLRLSRPVN 249
            :.....:|..:|.:..:.                ||:.....|..|:.....||:|:::||.||.
  Fly    80 SELQVRVGSTSRSSGGEV----------------VTVRAFKYHEGYNSKLMINDVAIIKLSSPVR 128

  Fly   250 WLQMQNLEPVCLPPQRGRYANQLAGSAADVSGWGKT--ESSGSSKIKQKAMLHIQPQDQCQEAFY 312
              |...:..:.|..     :..::|:.|.|||||.|  ....|....||..:.:.....|....|
  Fly   129 --QTSKIRAIELAD-----SEAVSGTNAVVSGWGTTCFLFCSSPDTLQKVEVDLLHYKDCAADTY 186

  Fly   313 KDTKITLADSQMCAGGEIGVDSCSGDSGGPLTVEANTASGNRYVYLAGVVSIGRKHCGTALFSGI 377
            .....::.::.:||.|| ..|:|.|||||||..:      |:   |.||||.| ..|....:.|:
  Fly   187 NYGSDSILETMVCATGE-KKDACQGDSGGPLVAD------NK---LVGVVSWG-SGCAWTGYPGV 240

  Fly   378 YTRVSSYMDWIEST 391
            |..|:|...||..|
  Fly   241 YADVASLRSWIVDT 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser7NP_572582.1 CLIP 29..74 CDD:197829
Tryp_SPc 131..388 CDD:214473 69/258 (27%)
Tryp_SPc 133..391 CDD:238113 70/259 (27%)
CG17571NP_001286096.1 Tryp_SPc 30..251 CDD:214473 69/258 (27%)
Tryp_SPc 31..254 CDD:238113 70/260 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.