DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser7 and CG4650

DIOPT Version :9

Sequence 1:NP_572582.1 Gene:Ser7 / 31917 FlyBaseID:FBgn0019929 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_609722.2 Gene:CG4650 / 34859 FlyBaseID:FBgn0032549 Length:299 Species:Drosophila melanogaster


Alignment Length:280 Identity:71/280 - (25%)
Similarity:108/280 - (38%) Gaps:48/280 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   124 CGSAFSFRLVGGHNTGLFEFPWTTLLEYETVSGGKDYACGASFIAQRWLLTAAHCIHTMGRNLTA 188
            ||     .|..|........||...|....:.    |.||.:.|.::.:||||||  |.......
  Fly    28 CG-----LLTNGKIANNISSPWMAYLHTSELL----YVCGGTVITEKLVLTAAHC--TRASEQLV 81

  Fly   189 AILGEWNRDTDPDCENDLNGVRECAPPHIRVTIDRILPHAQYSELNYRNDIALLRLSRPVNWLQM 253
            |.:||: ..||...:..|:          ...:.:...|:.|:.....||||:|.|:..:  :..
  Fly    82 ARIGEF-IGTDDANDTMLS----------EYQVSQTFIHSLYNTTTSANDIAILGLATDI--VFS 133

  Fly   254 QNLEPVCLP--PQRGRYANQ---LAGSAADVSGWGKTESSGSSKIKQKAMLHIQPQDQCQEAFYK 313
            :.:.|:|:.  ....:|.:.   |:|:.     ||.......|...:...:..||.:.|...   
  Fly   134 KTIRPICIVWWTIWRKYIDNIQVLSGAQ-----WGLPNDRNESDAFRITDIRRQPANMCSTL--- 190

  Fly   314 DTKITLADSQMCAGGEIGVDS--CSGDSGGPLTVEANTASGNRYVYLAGVVSIGRKHCGTALFSG 376
             ....:..||.|||..   ||  |:.|...||.......:..||| |.|:.:..:| |..|   .
  Fly   191 -NGTAILSSQFCAGDS---DSKLCNVDFSSPLGAIITFKNIQRYV-LIGIATTNQK-CKRA---S 246

  Fly   377 IYTRVSSYMDWIESTIRANR 396
            :||.|.|:.|:|.|..|..|
  Fly   247 VYTDVLSHTDFILSVWRQYR 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser7NP_572582.1 CLIP 29..74 CDD:197829
Tryp_SPc 131..388 CDD:214473 65/263 (25%)
Tryp_SPc 133..391 CDD:238113 65/264 (25%)
CG4650NP_609722.2 Tryp_SPc 33..258 CDD:214473 64/260 (25%)
Tryp_SPc 33..258 CDD:304450 64/260 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.