DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser7 and Send2

DIOPT Version :9

Sequence 1:NP_572582.1 Gene:Ser7 / 31917 FlyBaseID:FBgn0019929 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_609708.2 Gene:Send2 / 34836 FlyBaseID:FBgn0264253 Length:239 Species:Drosophila melanogaster


Alignment Length:274 Identity:80/274 - (29%)
Similarity:113/274 - (41%) Gaps:70/274 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   131 RLVGGHNTGLFEFPWTTLLEYETVSGGKDYACGASFIAQRWLLTAAHCIHTMGRNLTAAILGEWN 195
            |::||...|:.|.||...::.:    || :.||.|..:...::|||||:...|..:.|.      
  Fly    26 RIIGGQPIGIEEAPWQVSIQRD----GK-HLCGGSIYSADIIITAAHCVQGQGYQVRAG------ 79

  Fly   196 RDTDPDCENDLNGVRECAPPHIRVTIDRILPHAQYSELNYRNDIALLRLSRPVNWLQMQNLEPVC 260
                ...:|....|         |.:..|..|.     ...||||::|||:|:.:  ...::|:.
  Fly    80 ----SALKNSNGSV---------VDVAAIRTHE-----GLGNDIAIVRLSKPLEF--TNQVQPIP 124

  Fly   261 L----PPQRGRYANQLAGSAADVSGWGKTESSGSSKIKQKAMLHIQPQDQCQEAFYKDTKITLAD 321
            |    ||         .||.|.|||||.:.........|...|:||....|.         ....
  Fly   125 LAKTNPP---------PGSIAFVSGWGSSSYYSHPIDLQGVNLYIQWPYYCG---------LTEP 171

  Fly   322 SQMCAGGEIGVDSCSGDSGGPLTVEANTASGNRYVYLAGVVSIGRKHCGTALFSGIYTRVSSYMD 386
            |::|| |..|..:|.|||||||..:..         |.||||.|.|.|   .:|.|||.|..:.:
  Fly   172 SRICA-GSFGRAACKGDSGGPLVFDQQ---------LVGVVSGGTKDC---TYSSIYTSVPYFRE 223

  Fly   387 W----IESTIRANR 396
            |    |:..:.|||
  Fly   224 WILNAIDEIMSANR 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser7NP_572582.1 CLIP 29..74 CDD:197829
Tryp_SPc 131..388 CDD:214473 76/264 (29%)
Tryp_SPc 133..391 CDD:238113 76/265 (29%)
Send2NP_609708.2 Tryp_SPc 26..225 CDD:214473 75/260 (29%)
Tryp_SPc 27..225 CDD:238113 74/259 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.