DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser7 and OVCH2

DIOPT Version :9

Sequence 1:NP_572582.1 Gene:Ser7 / 31917 FlyBaseID:FBgn0019929 Length:397 Species:Drosophila melanogaster
Sequence 2:XP_016873148.1 Gene:OVCH2 / 341277 HGNCID:29970 Length:569 Species:Homo sapiens


Alignment Length:319 Identity:88/319 - (27%)
Similarity:140/319 - (43%) Gaps:66/319 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   110 RPPSGIDQLPEHPYCGSA------------FSFRLVGGHNTGLFEFPWTTLLEYETVSGGKDYAC 162
            |..|....||:.|.||.:            || |::||.......:||...|:..     :.:.|
Human    23 RGKSATLSLPKAPSCGQSLVKVQPWNYFNIFS-RILGGSQVEKGSYPWQVSLKQR-----QKHIC 81

  Fly   163 GASFIAQRWLLTAAHCIHTMGRNLTAAI---LGEWN-RDTDPDCENDLNGVRECAPPHIRVTIDR 223
            |.|.::.:|::||||||  ..||:.:.:   .||:: ..|||..:.              :||:.
Human    82 GGSIVSPQWVITAAHCI--ANRNIVSTLNVTAGEYDLSQTDPGEQT--------------LTIET 130

  Fly   224 ILPHAQYS---ELNYRNDIALLRLSRPVNWLQMQNLEPVCLPPQRGRYANQLAGSAADVSGWGK- 284
            ::.|..:|   .::|  |||||:::....:...  :.|:|||..|.::.   ||.....:|||: 
Human   131 VIIHPHFSTKKPMDY--DIALLKMAGAFQFGHF--VGPICLPELREQFE---AGFICTTAGWGRL 188

  Fly   285 TESSGSSKIKQKAMLHIQPQDQCQEAFYKDTKITLADSQMCAG-GEIGVDSCSGDSGGPLTVEAN 348
            ||....|::.|:..|.|...::|..|.....:.....:.:|.| .:.|.|:|.|||||.|.....
Human   189 TEGGVLSQVLQEVNLPILTWEECVAALLTLKRPISGKTFLCTGFPDGGRDACQGDSGGSLMCRNK 253

  Fly   349 TASGNRYVYLAGVVSIGRKHCGTALFS----------GIYTRVSSYMDWIESTIR-ANR 396
            ..:..    ||||.|.| ..||....:          ||:|.:|..:.||...|: .||
Human   254 KGAWT----LAGVTSWG-LGCGRGWRNNVRKSDQGSPGIFTDISKVLPWIHEHIQTGNR 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser7NP_572582.1 CLIP 29..74 CDD:197829
Tryp_SPc 131..388 CDD:214473 74/275 (27%)
Tryp_SPc 133..391 CDD:238113 75/276 (27%)
OVCH2XP_016873148.1 Tryp_SPc 55..298 CDD:214473 74/275 (27%)
Tryp_SPc 56..301 CDD:238113 75/277 (27%)
CUB 320..424 CDD:238001
CUB 435..546 CDD:238001
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.