DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser7 and CG4259

DIOPT Version :9

Sequence 1:NP_572582.1 Gene:Ser7 / 31917 FlyBaseID:FBgn0019929 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_001259904.1 Gene:CG4259 / 33385 FlyBaseID:FBgn0031389 Length:270 Species:Drosophila melanogaster


Alignment Length:264 Identity:65/264 - (24%)
Similarity:101/264 - (38%) Gaps:54/264 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   143 FPWTTLLEYETVSGGKD----YACGASFIAQRWLLTAAHCIHTMGRNLTAAILGEWNRDTDPDCE 203
            |||..     :|...:|    |....|.|....:|||||.::...:.......|||:..|..|.:
  Fly    39 FPWVV-----SVLDQRDWLFRYIGVGSLINPNVVLTAAHILNGTTKYDLVVRAGEWDTSTTADQQ 98

  Fly   204 NDLNGVRECAPPHIRVTIDRILPHAQYSELNYRNDIALLRLSRPVNWLQMQNLEPVCLPPQRGRY 268
                        |:.:.:..|:.|.|::..|..|::|||.|..........||.|:.|       
  Fly    99 ------------HVDLEVLNIVSHEQFNRFNAENNMALLILVSAFEMTANINLIPLYL------- 144

  Fly   269 ANQLAG---SAADVSGWGKT--ESSGSSKIKQKAMLHIQPQDQCQEAFYKDTKITLADSQMCAGG 328
              |.||   .:...:||||.  .|:....:.:...:.:.....|...       .|...|:|..|
  Fly   145 --QEAGIQKGSCFFNGWGKVYLNSTDYPTVLKTVQVDLLSMGMCSSR-------KLPIQQICGKG 200

  Fly   329 EIGVDSCSGDSGGPLTVEANTASGNRYVY---LAGVVS-IGRKHCGTALFSGIYTRVSSYMDWIE 389
            ..|:| ||||.|.||.....|     |.|   ..|:|: :.:|.......  ::|.|:..:.||:
  Fly   201 LEGID-CSGDGGAPLVCRILT-----YPYKYAQVGIVNWLSQKPVENTFI--VFTNVAGLLPWID 257

  Fly   390 STIR 393
            ..:|
  Fly   258 YHLR 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser7NP_572582.1 CLIP 29..74 CDD:197829
Tryp_SPc 131..388 CDD:214473 62/257 (24%)
Tryp_SPc 133..391 CDD:238113 64/260 (25%)
CG4259NP_001259904.1 Tryp_SPc 39..259 CDD:238113 64/260 (25%)
Tryp_SPc 39..256 CDD:214473 62/257 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24258
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.