DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser7 and AgaP_AGAP012817

DIOPT Version :9

Sequence 1:NP_572582.1 Gene:Ser7 / 31917 FlyBaseID:FBgn0019929 Length:397 Species:Drosophila melanogaster
Sequence 2:XP_560999.5 Gene:AgaP_AGAP012817 / 3292527 VectorBaseID:AGAP012817 Length:439 Species:Anopheles gambiae


Alignment Length:290 Identity:70/290 - (24%)
Similarity:117/290 - (40%) Gaps:49/290 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   124 CGSAFSFRLVGGHNTGLFEFPWT--TLLEYETVSGGKDYACGASFIAQRWLLTAAHCIHTMGRNL 186
            ||:.....|..|....|   ||.  .|.:.|.|.      |..:.|::.:::..|.|.....::|
Mosquito   180 CGTKSETVLDNGQPAPL---PWLGFVLTKEEKVK------CVVTLISEWYVVGTASCFEKNEKDL 235

  Fly   187 TAAILGEWNRDTDPDCENDLNGVRECAPPHIRVTIDRILPHAQYSELNYRNDIALLRLSRPVNWL 251
             ..:.|.:....:..| .:.||...||.|....:|.|::.|.::|:....::|||:.|..|.:..
Mosquito   236 -RILFGGYEDLLEQKC-FERNGSTVCAYPTQSRSIGRVVAHPRFSKNTINDNIALIELQSPADTT 298

  Fly   252 QMQNLEPVCLPPQRGRYANQLAGSAADVSGWGKTESSG-------SSKIKQKAMLHIQPQDQCQE 309
            | .:::|:|||.....|.|             :||:..       :..|..:::.|:.| |.|:.
Mosquito   299 Q-PHVKPICLPVTPTLYTN-------------RTENFSVLAFRLTTGTIVDQSVNHVDP-DFCKS 348

  Fly   310 -----AFYKDTKITLADSQMCAG-GEIGVDSCSG--DSGGPLTVEANTA-SGNRYVYLAGVVSIG 365
                 .|..|.:    :...|.. .|..|.:|..  ..|.||....:.. :|.||| |.|...:|
Mosquito   349 VHIVAGFAIDNE----EKSFCVSVPEEDVANCDSLLGQGTPLQEHVSMVNAGERYV-LRGFDLLG 408

  Fly   366 RKHCGTALFSGIYTRVSSYMDWIESTIRAN 395
            ....|.:....:|..|.||:||:...:|.|
Mosquito   409 LTCAGDSSIPVLYVNVYSYLDWMLYNMRYN 438

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser7NP_572582.1 CLIP 29..74 CDD:197829
Tryp_SPc 131..388 CDD:214473 65/274 (24%)
Tryp_SPc 133..391 CDD:238113 65/275 (24%)
AgaP_AGAP012817XP_560999.5 Tryp_SPc <1..150 CDD:238113
Tryp_SPc 190..430 CDD:214473 63/270 (23%)
Tryp_SPc 190..430 CDD:304450 63/270 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.