DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser7 and AgaP_AGAP008997

DIOPT Version :9

Sequence 1:NP_572582.1 Gene:Ser7 / 31917 FlyBaseID:FBgn0019929 Length:397 Species:Drosophila melanogaster
Sequence 2:XP_319746.4 Gene:AgaP_AGAP008997 / 3291872 VectorBaseID:AGAP008997 Length:248 Species:Anopheles gambiae


Alignment Length:272 Identity:100/272 - (36%)
Similarity:145/272 - (53%) Gaps:44/272 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   131 RLVGGHNTGLFEFPWTTLLEYETVSGG---KDYACGASFIAQRWLLTAAHCIHTMGRNLTAAILG 192
            |:||||::|....||...|    :..|   |..:||.:.|:.||::|||||:.|   ||... ||
Mosquito     7 RIVGGHSSGFGTHPWQAAL----IKSGFLTKKLSCGGALISNRWVVTAAHCVAT---NLKVR-LG 63

  Fly   193 EWN-RDTDPDCENDLNGVRECAPPHIRVTIDRILPHAQYSELNYRNDIALLRLSRPVNWLQMQNL 256
            ||: ||            :|....|...:|:|...|..||..::||||||::|.|.|  :..|::
Mosquito    64 EWDVRD------------QEERLTHEEYSIERKEVHPNYSPSDFRNDIALVKLDRKV--VFRQHI 114

  Fly   257 EPVCLPPQRGRYANQLAGSAADVSGWGKTESSGSS--KIKQKAMLHIQPQDQCQEAF-YKDTKIT 318
            .||||||:    :.:|.|..|.|:|||:|....|:  .:.|:..:.:.|.::||..| ....:.|
Mosquito   115 LPVCLPPK----SVKLVGKMATVAGWGRTRHGQSTVPSVLQEVDVEVIPNERCQRWFRAAGRRET 175

  Fly   319 LADSQMCAG-GEIGVDSCSGDSGGPLTVEANTASGNRYVYLAGVVS--IGRKHCGTALFSGIYTR 380
            :.|..:||| .|.|.|||.||||||||:   :..|.:  .|.|:||  ||   ||.....|:||.
Mosquito   176 IHDVFLCAGYKEGGRDSCQGDSGGPLTL---SIEGRK--TLIGLVSWGIG---CGREHLPGVYTN 232

  Fly   381 VSSYMDWIESTI 392
            :..::.|||..:
Mosquito   233 IQKFVPWIEKVM 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser7NP_572582.1 CLIP 29..74 CDD:197829
Tryp_SPc 131..388 CDD:214473 97/266 (36%)
Tryp_SPc 133..391 CDD:238113 99/267 (37%)
AgaP_AGAP008997XP_319746.4 Tryp_SPc 7..240 CDD:214473 97/266 (36%)
Tryp_SPc 8..243 CDD:238113 99/268 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.