DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser7 and AgaP_AGAP008996

DIOPT Version :9

Sequence 1:NP_572582.1 Gene:Ser7 / 31917 FlyBaseID:FBgn0019929 Length:397 Species:Drosophila melanogaster
Sequence 2:XP_552892.3 Gene:AgaP_AGAP008996 / 3291870 VectorBaseID:AGAP008996 Length:249 Species:Anopheles gambiae


Alignment Length:270 Identity:82/270 - (30%)
Similarity:130/270 - (48%) Gaps:34/270 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   131 RLVGGHNTGLFEFPW-TTLLEYETVSGGKDYACGASFIAQRWLLTAAHCIHTMGRNLTAAILGEW 194
            |:|||.......:|| .:|.::.|.:  ..:.|||:.:.:.|.:|||||:..:..:.....|||:
Mosquito     6 RIVGGTKAAFGRWPWQISLRQWRTST--YLHKCGAALLNENWAITAAHCVDNVPPSDLLLRLGEY 68

  Fly   195 NRDTDPDCENDLNGVRECAPPHIRVTIDRILPHAQYSELNYRNDIALLRLSRPVNWLQMQNLEPV 259
                |...|.:..|.:|     .||.|  :..|.|:....:..|:||||...||  :...|:.||
Mosquito    69 ----DLALEEEPYGYQE-----RRVQI--VASHPQFDPRTFEYDLALLRFYEPV--VFQPNIIPV 120

  Fly   260 CLPPQRGRYANQLAGSAADVSGWGKTESSGS-SKIKQKAMLHIQPQDQCQEAFYKDTKIT--LAD 321
            |:|.....:    .|..|.|:|||:....|. ..:.|:..:.:...:.| |..|:.....  :..
Mosquito   121 CVPENDENF----IGRTAFVTGWGRLYEDGPLPSVLQEVTVPVIENNIC-ETMYRSAGYIEHIPH 180

  Fly   322 SQMCAGGEI-GVDSCSGDSGGPLTVEANTASGNRYVYLAGVVS--IGRKHCGTALFSGIYTRVSS 383
            ..:|||.:. |.|||.||||||:.::   .:..|:: ||||:|  ||   |......|:|||:|.
Mosquito   181 IFICAGWKKGGYDSCEGDSGGPMVIQ---RTDKRFL-LAGVISWGIG---CAEPNQPGVYTRISE 238

  Fly   384 YMDWIESTIR 393
            :.|||...::
Mosquito   239 FRDWINQILQ 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser7NP_572582.1 CLIP 29..74 CDD:197829
Tryp_SPc 131..388 CDD:214473 80/263 (30%)
Tryp_SPc 133..391 CDD:238113 81/264 (31%)
AgaP_AGAP008996XP_552892.3 Tryp_SPc 6..243 CDD:214473 80/263 (30%)
Tryp_SPc 7..246 CDD:238113 81/265 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.