DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser7 and TRY3_ANOGA

DIOPT Version :9

Sequence 1:NP_572582.1 Gene:Ser7 / 31917 FlyBaseID:FBgn0019929 Length:397 Species:Drosophila melanogaster
Sequence 2:XP_317171.2 Gene:TRY3_ANOGA / 3291693 VectorBaseID:AGAP008294 Length:268 Species:Anopheles gambiae


Alignment Length:285 Identity:83/285 - (29%)
Similarity:121/285 - (42%) Gaps:53/285 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   106 RTTPRPPSGIDQLPEHPYCGSAFSFRLVGGHNTGLFEFPWTTLLEYETVSGGKDYACGASFIAQR 170
            |..|||...:             ..|:|||....:.|.|:...|:|     ...:.||.|.:..:
Mosquito    29 RFLPRPKYDV-------------GHRIVGGFEIDVSETPYQVSLQY-----FNSHRCGGSVLNSK 75

  Fly   171 WLLTAAHCIHTMGRNLTAAILGEWNRDTDPDCENDLNGVRECAPPHIRVTIDRILPHAQYSELNY 235
            |:||||||...:..:..|..||....                |.....|.:.|:|.|..|.:...
Mosquito    76 WILTAAHCTVNLQPSSLAVRLGSSRH----------------ASGGTVVRVARVLEHPNYDDSTI 124

  Fly   236 RNDIALLRLSRPVNWLQMQNLEPVCLPPQRGRYANQLAGSAADVSGWGKTESSG-SSKIKQKAML 299
            ..|.:|:.|...:.:..:  ::||.||.|.....:   |:...|||||.|:|:. |:.|.:.|.:
Mosquito   125 DYDFSLMELESELTFSDV--VQPVSLPDQDEAVED---GTMTIVSGWGNTQSAAESNAILRAANV 184

  Fly   300 HIQPQDQCQEAFYKDTKITLADSQMCAGGEI-GVDSCSGDSGGPLTVEANTASGNRYVYLAGVVS 363
            ....|.:|..|:.....||  |..:|||.:. |.|:|.|||||||.|:..         |.||||
Mosquito   185 PTVNQKECTIAYSSSGGIT--DRMLCAGYKRGGKDACQGDSGGPLVVDGK---------LVGVVS 238

  Fly   364 IGRKHCGTALFSGIYTRVSSYMDWI 388
            .| ..|....:.|:|.||:...||:
Mosquito   239 WG-FGCAMPGYPGVYARVAVVRDWV 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser7NP_572582.1 CLIP 29..74 CDD:197829
Tryp_SPc 131..388 CDD:214473 78/258 (30%)
Tryp_SPc 133..391 CDD:238113 78/258 (30%)
TRY3_ANOGAXP_317171.2 Tryp_SPc 41..262 CDD:214473 78/258 (30%)
Tryp_SPc 42..265 CDD:238113 78/259 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.