DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser7 and AgaP_AGAP008276

DIOPT Version :9

Sequence 1:NP_572582.1 Gene:Ser7 / 31917 FlyBaseID:FBgn0019929 Length:397 Species:Drosophila melanogaster
Sequence 2:XP_555189.1 Gene:AgaP_AGAP008276 / 3291691 VectorBaseID:AGAP008276 Length:272 Species:Anopheles gambiae


Alignment Length:261 Identity:75/261 - (28%)
Similarity:119/261 - (45%) Gaps:49/261 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   132 LVGGHNTGLFEFPWTTLLEYETVSGGKDYACGASFIAQRWLLTAAHCIHTMGRNLTAAILGEWNR 196
            :|||....:.:.|:...:    ::.|:.: ||.|.|..||:|||.||:..:..|.....:|..| 
Mosquito    39 IVGGMKVDIEQVPYQAAI----LTLGQVH-CGGSIIGPRWVLTAYHCVDWLLPNFYEVAVGSTN- 97

  Fly   197 DTDPDCENDLNGVRECAPPH--IRVTIDRI-LPHAQYSELNYRNDIALLRLSRPVNWLQMQNLEP 258
                              |:  .|:.:..: :|....|:.|:  ||||.:|:..:.:.....   
Mosquito    98 ------------------PYEGQRILVQELFVPLETLSDPNF--DIALAKLAHTLQYSSTVQ--- 139

  Fly   259 VCLPPQRGRYANQLAGSAADVSGWGKTESSGSSKIKQKAMLHIQPQDQCQEAFYKDTKITLADSQ 323
             |:|..... ::.:..:.|.:||:|.|:...|..|.:.|.:.:.|.|.||:|:    ...:.:..
Mosquito   140 -CIPLLTSD-SSLIPDTPAYISGFGYTKERASDNILKAAQIKVLPWDYCQQAY----PYLMREFM 198

  Fly   324 MCAGGEIG-VDSCSGDSGGPLTVEANTASGNRYVYLAGVVSIGRKHCGTALFSGIYTRVSSYMDW 387
            :|||.:.| ||||.|||||||.|.|.         |||||..| :.|....|.|:|..|..:.||
Mosquito   199 LCAGFKEGKVDSCQGDSGGPLIVNAK---------LAGVVFYG-EGCARPHFPGVYISVPWFSDW 253

  Fly   388 I 388
            |
Mosquito   254 I 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser7NP_572582.1 CLIP 29..74 CDD:197829
Tryp_SPc 131..388 CDD:214473 73/259 (28%)
Tryp_SPc 133..391 CDD:238113 75/260 (29%)
AgaP_AGAP008276XP_555189.1 Tryp_SPc 39..257 CDD:238113 75/261 (29%)
Tryp_SPc 39..254 CDD:214473 73/259 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.