DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser7 and AgaP_AGAP012034

DIOPT Version :9

Sequence 1:NP_572582.1 Gene:Ser7 / 31917 FlyBaseID:FBgn0019929 Length:397 Species:Drosophila melanogaster
Sequence 2:XP_552174.3 Gene:AgaP_AGAP012034 / 3291492 VectorBaseID:AGAP012034 Length:217 Species:Anopheles gambiae


Alignment Length:236 Identity:72/236 - (30%)
Similarity:109/236 - (46%) Gaps:35/236 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   167 IAQRWLLTAAHCIHTMGRNLTAAILGEWNRDTDPDCENDLNGVRECAPPHIRVTIDR----ILPH 227
            |.:|::||||||:|.:.........|.:...|...|..|            ||..:|    ::.|
Mosquito     2 IHERYVLTAAHCVHNLKLENIKLYFGLFLISTLAQCLAD------------RVCQERRAAELIVH 54

  Fly   228 AQYSELNYRNDIALLRLSRPVNWLQMQNLEPVCLPPQRGRYANQLAGSAADVS-GWGKTESSGSS 291
            ..|:.....|||||:|::..|.:  ..::.|.|||... .:...||..|..:| |||....|   
Mosquito    55 QDYNSHARLNDIALIRVNEAVQF--TDDVRPACLPLDY-LFDESLANDARVLSLGWGTMSDS--- 113

  Fly   292 KIKQKAMLHIQPQDQCQEAFYKDTKI--TLADSQMC-AGGEIGVDSCSGDSGGPLTVEANTASGN 353
              |:...|::..|::|.|...|..:.  ::..|.|| .|.:.|.|.|.||||.|:.    .....
Mosquito   114 --KRIVALNVIEQEECGEQLRKWQRFNASMLFSVMCTVGVQAGQDVCQGDSGAPIL----QLKDG 172

  Fly   354 RYVYLAGVVSIGRKHCGTAL-FSGIYTRVSSYMDWIESTIR 393
            |: :|.||||.|.| ||.:. .:|:..|||.|.:||.:.::
Mosquito   173 RF-FLVGVVSFGPK-CGMSTGKAGMSMRVSEYTNWILTNLK 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser7NP_572582.1 CLIP 29..74 CDD:197829
Tryp_SPc 131..388 CDD:214473 70/229 (31%)
Tryp_SPc 133..391 CDD:238113 72/232 (31%)
AgaP_AGAP012034XP_552174.3 Tryp_SPc 2..206 CDD:214473 70/229 (31%)
Tryp_SPc 2..206 CDD:238113 70/229 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.