DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser7 and AgaP_AGAP011917

DIOPT Version :9

Sequence 1:NP_572582.1 Gene:Ser7 / 31917 FlyBaseID:FBgn0019929 Length:397 Species:Drosophila melanogaster
Sequence 2:XP_552323.2 Gene:AgaP_AGAP011917 / 3291454 VectorBaseID:AGAP011917 Length:246 Species:Anopheles gambiae


Alignment Length:260 Identity:59/260 - (22%)
Similarity:110/260 - (42%) Gaps:42/260 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   131 RLVGGHNTGLFEFPWTTLLEYETVSGGKDYACGASFIAQRWLLTAAHCIHTMGRNLTAAILGEWN 195
            |:|||.:....:.||...|.    :....:.||.:.::.|::|::|:|:.......|.|:.|...
Mosquito    23 RIVGGIDAVAGDAPWMVSLR----NSINQHLCGGTLLSNRFVLSSANCLSGRLATATMAVAGSRF 83

  Fly   196 RDTDPDCENDLNGVRECAPPHIRVTIDRILPHAQYSELNYRNDIALLRLSRPVNWLQMQNLEPVC 260
            .:|             .|.|:..:   :|:.|..::.....:|:||.:.:  :.::..|:::|:.
Mosquito    84 LNT-------------AAIPYYGI---QIITHPNFNVNTLEHDVALFQTA--LQFILTQSVQPLP 130

  Fly   261 LPPQRGRYANQL-AGSAADVSGWGKTESS-GSSKIKQKAMLHIQPQDQCQEAFYKDTKITLADSQ 323
            |.      |:.: .|..|.|.|||.:::: |::...|...::....|.|.. |.......:..|.
Mosquito   131 LS------ADVIGVGVRARVFGWGASQANGGNTNALQFLNVNTLSNDDCAN-FLGAEGWRIGPSS 188

  Fly   324 MCAGGEIGVDSCSGDSGGPLTVEANTASGNRYVYLAGVVSIGRKHCGTALFSGIYTRVSSYMDWI 388
            :|.....|...|.||.||.|.::.         |..||.|.|.. |.|.. ..::.|:|:...||
Mosquito   189 LCTLTREGQGICGGDEGGALVLDN---------YAIGVASWGIP-CATGR-PDVFVRISAVRSWI 242

  Fly   389  388
            Mosquito   243  242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser7NP_572582.1 CLIP 29..74 CDD:197829
Tryp_SPc 131..388 CDD:214473 57/258 (22%)
Tryp_SPc 133..391 CDD:238113 58/258 (22%)
AgaP_AGAP011917XP_552323.2 Tryp_SPc 23..242 CDD:214473 57/258 (22%)
Tryp_SPc 24..242 CDD:238113 56/257 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.