DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser7 and AgaP_AGAP011909

DIOPT Version :9

Sequence 1:NP_572582.1 Gene:Ser7 / 31917 FlyBaseID:FBgn0019929 Length:397 Species:Drosophila melanogaster
Sequence 2:XP_320620.4 Gene:AgaP_AGAP011909 / 3291449 VectorBaseID:AGAP011909 Length:400 Species:Anopheles gambiae


Alignment Length:307 Identity:88/307 - (28%)
Similarity:125/307 - (40%) Gaps:40/307 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 TTNATSSTTTLKLL-PRTTPRPPSGIDQLPEHPYCGSAFSFRLVGGHNTGLFEFPWTTLLEYETV 154
            :|.:|.|..|:.|| |.|:...............||...:.::|||..|.:.|||....|    |
Mosquito   113 STESTYSGLTIALLVPGTSKGGRFFCTATKIECQCGMRRTRKIVGGEETLVNEFPMMAAL----V 173

  Fly   155 SG---GKDYACGASFIAQRWLLTAAHCIHTMGRNLT--AAILGEWNRDTDPDCENDLNGVRECAP 214
            .|   |:...|||:.|.....:|||||.  |||::.  |.::||.:..|..:           :|
Mosquito   174 DGSKSGEGIFCGATIITNYHAVTAAHCY--MGRSIANLALLVGEHDITTGSE-----------SP 225

  Fly   215 PHIRVTIDRILPHAQYSEL--NYRNDIALLRLSRPVNWLQMQNLEPVCLPPQRGRYANQLAGSAA 277
            ....:.:..|..|..||..  :..||||::|....:  |....:.|.|||.:  .......|...
Mosquito   226 YTALLLLASIKIHEGYSSTTSSSSNDIAIVRTRTEI--LFNAGVGPACLPIK--FVGASFVGIQL 286

  Fly   278 DVSGWGKTE-SSGSSKIKQKAMLHIQPQDQCQEAFYKDTKITLADSQMCAGGEIGVDSCSGDSGG 341
            :..|||..: .:..|.:..|..|.:....|| .|.|....   |..|:|.... ..|:|..||||
Mosquito   287 EAVGWGTLDYGAPKSNVPMKVALPVVNPSQC-SALYPTFS---AQQQLCTLTP-NKDTCQSDSGG 346

  Fly   342 PLTVEANTASGNRYVYLAGVVSIGRKHCGTALFSGIYTRVSSYMDWI 388
            ||..   |.:.|:..||.|.:..|.. |.|...| :.|.|..|..||
Mosquito   347 PLFY---TDAYNKRAYLLGTIGYGIA-CATDRPS-VSTNVLYYTQWI 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser7NP_572582.1 CLIP 29..74 CDD:197829
Tryp_SPc 131..388 CDD:214473 76/264 (29%)
Tryp_SPc 133..391 CDD:238113 78/264 (30%)
AgaP_AGAP011909XP_320620.4 CUB 52..123 CDD:294042 3/9 (33%)
Tryp_SPc 154..388 CDD:214473 76/264 (29%)
Tryp_SPc 155..391 CDD:238113 78/265 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.