DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser7 and AgaP_AGAP007262

DIOPT Version :9

Sequence 1:NP_572582.1 Gene:Ser7 / 31917 FlyBaseID:FBgn0019929 Length:397 Species:Drosophila melanogaster
Sequence 2:XP_564960.3 Gene:AgaP_AGAP007262 / 3290331 VectorBaseID:AGAP007262 Length:316 Species:Anopheles gambiae


Alignment Length:314 Identity:95/314 - (30%)
Similarity:140/314 - (44%) Gaps:54/314 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   104 LPRTTPRPPSGID-----QLPEHPYCGSAF-----------SFRLVGGHNTGLFEFPWTTLLEYE 152
            ||.|:.....|||     .:.|..:..:.|           :.|:|.|......:||:...|..:
Mosquito    22 LPTTSSSSSFGIDWSEVRPIEEFDHIKAHFRTPTTATQNTPNRRIVNGQEARPGQFPYQVALLGQ 86

  Fly   153 TVSG-GKDYACGASFIAQRWLLTAAHCIH------TMGRNLTAAILGEWNRDTDPDCENDLNGVR 210
            ..|| |   .||||.|.||::||||||::      |...|.| ||||..||           .:.
Mosquito    87 FNSGVG---LCGASIITQRYVLTAAHCVYIGVDASTPVANGT-AILGAHNR-----------MIE 136

  Fly   211 ECAPPHIRVTIDRILPHAQYSELNYRNDIALLRLSRPVNWLQMQNLEPVCLPPQRGRY-ANQLAG 274
            |.:...|..:...::.|..|...:.|||||::||..|:  |....::|:.||   ||. ....||
Mosquito   137 EPSQQRITFSASGVIGHPGYDLFDVRNDIAVVRLDEPI--LYTDRIQPIRLP---GRSDTRTFAG 196

  Fly   275 SAADVSGWG--KTESSGSSKIKQKAMLHIQPQDQCQEAFYKDTKITLADSQMCAGGEIGVDSCSG 337
            ....|||:|  .|.:.|.|.:....:..:.....|:.| :...:..:....:|..|:.|..:|:.
Mosquito   197 LMGTVSGYGVYSTANPGLSDVLNYVLNPVITNADCRAA-WSGFEWLIEPQNVCQSGDGGRSACNS 260

  Fly   338 DSGGPLTVEANTASGNRYVYLAGVVSIGRK-HCGTALFSGIYTRVSSYMDWIES 390
            ||||||||:.|..|     ...||||.|.. .|...: ..::.||:.|:||||:
Mosquito   261 DSGGPLTVQDNGES-----LQVGVVSFGSAGGCDNGI-PTVFARVTYYLDWIEA 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser7NP_572582.1 CLIP 29..74 CDD:197829
Tryp_SPc 131..388 CDD:214473 84/267 (31%)
Tryp_SPc 133..391 CDD:238113 86/269 (32%)
AgaP_AGAP007262XP_564960.3 Tryp_SPc 65..306 CDD:214473 84/267 (31%)
Tryp_SPc 66..309 CDD:238113 86/270 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.