DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser7 and AgaP_AGAP007141

DIOPT Version :9

Sequence 1:NP_572582.1 Gene:Ser7 / 31917 FlyBaseID:FBgn0019929 Length:397 Species:Drosophila melanogaster
Sequence 2:XP_565054.3 Gene:AgaP_AGAP007141 / 3290313 VectorBaseID:AGAP007141 Length:254 Species:Anopheles gambiae


Alignment Length:268 Identity:71/268 - (26%)
Similarity:120/268 - (44%) Gaps:47/268 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   131 RLVGGHNTGLFEFPWTTLLEYETVSGGKDYACGASFIAQRWLLTAAHCIHTMGRNLTAAILGEWN 195
            |:|||.:......|:...|:     |...::||.:.|.:.|:||||||:.|..: .|..::|   
Mosquito    30 RVVGGTDAPPGAAPYQVSLQ-----GLFGHSCGGAIIDRDWILTAAHCVQTSVK-FTKVLVG--- 85

  Fly   196 RDTDPDCENDLNGVRECAPPHIRVTIDRILPHAQYSELNYRNDIALLRLSRPVNWLQMQNLEPVC 260
                   .|.||...:      |..:::...|::|:...:.|||||::|...:.:..:  ::|:.
Mosquito    86 -------TNLLNAGGQ------RYAVEKFYVHSRYNNPVFHNDIALVKLKSMIQYDDL--VQPIA 135

  Fly   261 LPPQRGRYANQ--LAGSAADVSGWGKTESSGSSKIK-QKAMLHIQPQDQCQEAFYKDTKITLADS 322
                   |:.:  ...:...::|||:...:|:...| |...|...|.::|:........:.:  .
Mosquito   136 -------YSEREIPENATLTLTGWGRLSGTGAMPNKLQTIDLTYVPYEECKRLHGNSENVDI--G 191

  Fly   323 QMCAGGEIGVDSCSGDSGGPLTVEANTASGNRYVYLAGVVSIGRKHCGTALFSGIYTRVSSYMDW 387
            .:|...:.|..:|:|||||||..|..         |.|||:.| ..|... :...|.|||.|.||
Mosquito   192 HVCTLTKKGEGACNGDSGGPLVYEGK---------LVGVVNFG-VPCALG-YPDAYARVSYYHDW 245

  Fly   388 IESTIRAN 395
            |.:||..|
Mosquito   246 IRTTIANN 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser7NP_572582.1 CLIP 29..74 CDD:197829
Tryp_SPc 131..388 CDD:214473 66/259 (25%)
Tryp_SPc 133..391 CDD:238113 67/260 (26%)
AgaP_AGAP007141XP_565054.3 Tryp_SPc 30..246 CDD:214473 66/259 (25%)
Tryp_SPc 31..249 CDD:238113 67/261 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.