DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser7 and AgaP_AGAP006676

DIOPT Version :9

Sequence 1:NP_572582.1 Gene:Ser7 / 31917 FlyBaseID:FBgn0019929 Length:397 Species:Drosophila melanogaster
Sequence 2:XP_316713.4 Gene:AgaP_AGAP006676 / 3290209 VectorBaseID:AGAP006676 Length:268 Species:Anopheles gambiae


Alignment Length:273 Identity:77/273 - (28%)
Similarity:122/273 - (44%) Gaps:37/273 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   131 RLVGGHNTGLFEFPWTT--LLEYETVSGGKDYACGASFIAQRWLLTAAHCIHTMGRNLTAAILGE 193
            |:.||......:||:|.  :.....:..|:   |..|.::..::||||.|:  .|.....|:||.
Mosquito    24 RVFGGDIATAGQFPYTVGLITRINILLTGQ---CAGSLVSANFILTAARCV--SGIQSAVAVLGG 83

  Fly   194 WNRDTDPDCENDLNGVRECAPPHIRVTIDRILPHAQYSELNYRNDIALLRLSRPVNWLQMQNLEP 258
            . |..:|:           .|..:|:|:...:.|.||.......|:||:||..||.:  ..|:.|
Mosquito    84 L-RINEPN-----------EPGAVRITVTDFIIHPQYEAEPDVFDVALVRLPLPVPF--SDNIRP 134

  Fly   259 VCLPPQRGRYANQLAGSAADVSGWGK-TESSGSSKIKQKAMLHIQPQDQCQEAFYKDTKITLADS 322
            |.||..|...|. ..|..|.|:|||: .|.:.:|::.:.....:.....|:.:...:   |:.|.
Mosquito   135 VRLPNLRQVEAT-FNGQQATVTGWGRFGEGTANSEVLRFGRSQVISTLACRLSLPTN---TILDQ 195

  Fly   323 QMCAGGEIGVDSCSGDSGGPLT-VEANTASGNRYVYLAGVVSIGRKHCGTALFSGIYTRVSSYMD 386
            .:|..| .....|.||.|.||| |:|:..:....|:  ..:||.....|.|   .::||:|||:.
Mosquito   196 HVCTDG-ANSSPCQGDVGAPLTIVDADGITTQIGVF--SFISILGCESGRA---AVHTRMSSYLT 254

  Fly   387 WI----ESTIRAN 395
            ||    :..||.|
Mosquito   255 WIGDNSDVEIRDN 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser7NP_572582.1 CLIP 29..74 CDD:197829
Tryp_SPc 131..388 CDD:214473 72/260 (28%)
Tryp_SPc 133..391 CDD:238113 73/265 (28%)
AgaP_AGAP006676XP_316713.4 Tryp_SPc 24..256 CDD:214473 72/260 (28%)
Tryp_SPc 25..256 CDD:238113 71/259 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.