DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser7 and AgaP_AGAP005663

DIOPT Version :9

Sequence 1:NP_572582.1 Gene:Ser7 / 31917 FlyBaseID:FBgn0019929 Length:397 Species:Drosophila melanogaster
Sequence 2:XP_556312.2 Gene:AgaP_AGAP005663 / 3290018 VectorBaseID:AGAP005663 Length:317 Species:Anopheles gambiae


Alignment Length:297 Identity:88/297 - (29%)
Similarity:131/297 - (44%) Gaps:77/297 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 QLPEHPYCGSAFSFRLVGGHNTGLFEFPW--TTLLEYETVSGGKDYACGASFIAQRWLLTAAHCI 179
            :||.|         |:..|......:||:  ..|..:.|.:|    .||.|.:...::||||||:
Mosquito    67 KLPSH---------RITNGQEATPGQFPYQIALLSNFATGTG----LCGGSVLTNNYILTAAHCV 118

  Fly   180 HTMGRNLT---AAILGEWNRDTDPDCENDLNGVRECAPPHIRVTIDRILPHAQYSELNYRNDIAL 241
            .:....|.   .||:|..||:           |.|.....|..|...|..|..|:..|.|||||:
Mosquito   119 ISGATTLATSGTAIMGAHNRN-----------VNEPTQQRIGFTSAGIRAHPGYNPTNIRNDIAV 172

  Fly   242 LRLSRPVNWLQMQNLEPVCLPPQRGRY-ANQLAGSAADVSGWGKTESSGSSK------------- 292
            :||:.|:.:  ...::|:.||   ||. :.|..|....|||:|:|.::|::.             
Mosquito   173 VRLNSPITF--TARIQPIRLP---GRSDSRQFGGFTGTVSGFGRTTNTGATSPVVMFTSNPVMTN 232

  Fly   293 ---IKQKAMLHIQPQDQCQEAFYKDTKITLADSQMCAGGEIGVDSCSGDSGGPLTVEANTASGNR 354
               |.:.....||||:                  :|..|:.|..||:|||||||||:   ..|:.
Mosquito   233 ADCIARWNTALIQPQN------------------VCLSGDGGRSSCNGDSGGPLTVQ---DGGSL 276

  Fly   355 YVYLAGVVSIG-RKHCGTALFSGIYTRVSSYMDWIES 390
            .:   |:||.| ...|...:.| :|.|||.|:|||::
Mosquito   277 QI---GIVSFGSAAGCSIGMPS-VYARVSFYLDWIDA 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser7NP_572582.1 CLIP 29..74 CDD:197829
Tryp_SPc 131..388 CDD:214473 83/279 (30%)
Tryp_SPc 133..391 CDD:238113 84/281 (30%)
AgaP_AGAP005663XP_556312.2 Tryp_SPc 72..307 CDD:214473 83/279 (30%)
Tryp_SPc 73..310 CDD:238113 84/282 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.