DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser7 and CG31220

DIOPT Version :9

Sequence 1:NP_572582.1 Gene:Ser7 / 31917 FlyBaseID:FBgn0019929 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_732440.2 Gene:CG31220 / 326126 FlyBaseID:FBgn0051220 Length:363 Species:Drosophila melanogaster


Alignment Length:389 Identity:111/389 - (28%)
Similarity:161/389 - (41%) Gaps:93/389 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 CIEKKDCD--FYAVDK-------LMELASKQQC------FSRQRPDLVCCPRETNIIPPLAPRIS 88
            ||..|||.  :|.|.:       .:.::..:.|      ..|.:...:|||:..|          
  Fly    33 CIRLKDCRPIYYNVRRNRLSGSAKVNISQTRMCGVSVRDRKRYKRIYICCPKPAN---------- 87

  Fly    89 NGTTNATSSTTTLKLLPRTTPRPPSGIDQLPEHPYCGS-AFSFRLVGGHNTGLFEFPWTTLLEYE 152
                                        .||.:|.||. ..:.|::||....|.|:||..:|.|.
  Fly    88 ----------------------------TLPSYPDCGKPQTTNRVIGGTEPNLNEYPWLAMLLYR 124

  Fly   153 TVSG-GKDY----ACGASFIAQRWLLTAAHCIHTMGRNLTAAILGEWNRDTDPDCENDLNGVR-E 211
            ..|. ..|.    :||.|.|..|::||||||:......:....|||.....:|||.:  .|.| .
  Fly   125 NRSAFNPDRELVPSCGGSLINTRYVLTAAHCVTDTVLQIQRVRLGEHTTSHNPDCIS--RGARIV 187

  Fly   212 CAPPHIRVTIDRILPHAQYSELNY--RNDIALLRLSRPVNWLQMQNLEPVCLPPQRGRYANQLAG 274
            |||.|:.:.::.|..|..|...||  ||||||:||..||.:...  ..|:|:..    |...|..
  Fly   188 CAPTHLDIDVESITSHNDYDPANYTFRNDIALVRLKEPVRYTMA--YYPICVLD----YPRSLMK 246

  Fly   275 SAADVSGWGKTES-SGSSKIKQKAMLHIQPQDQCQEAFYKDTKITLADS------QMCAGGEIGV 332
            ....|:|||||.. ...||:.:.|.:.::..::|.|.:        |..      |:||||....
  Fly   247 FKMYVAGWGKTGMFDTGSKVLKHAAVKVRKPEECSEKY--------AHRHFGPRFQICAGGLDNR 303

  Fly   333 DSCSGDSGGPLTVEANTASGNRY---VYLAGVVSIGRKHCGTALFSGIYTRVSSYMDWIESTIR 393
            .:|.||||.||.    ..||..|   .:|||:.|.|.. |||..:..::||.:.:..||.:.:|
  Fly   304 GTCDGDSGSPLM----GTSGRSYETITFLAGITSYGGP-CGTIGWPSVFTRTAKFYKWIRAHLR 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser7NP_572582.1 CLIP 29..74 CDD:197829 10/49 (20%)
Tryp_SPc 131..388 CDD:214473 90/274 (33%)
Tryp_SPc 133..391 CDD:238113 91/275 (33%)
CG31220NP_732440.2 Tryp_SPc 103..357 CDD:214473 90/274 (33%)
Tryp_SPc 104..360 CDD:238113 91/276 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 130 1.000 Domainoid score I5140
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D402896at33208
OrthoFinder 1 1.000 - - FOG0003849
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.