DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser7 and HPN

DIOPT Version :9

Sequence 1:NP_572582.1 Gene:Ser7 / 31917 FlyBaseID:FBgn0019929 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_001362370.1 Gene:HPN / 3249 HGNCID:5155 Length:417 Species:Homo sapiens


Alignment Length:277 Identity:90/277 - (32%)
Similarity:133/277 - (48%) Gaps:43/277 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   131 RLVGGHNTGLFEFPWTTLLEYETVSGGKDYACGASFIAQRWLLTAAHCIHTMGRNLTAAILGEWN 195
            |:|||.:|.|..:||...|.|:..     :.||.|.::..|:||||||.....|     :|..|.
Human   162 RIVGGRDTSLGRWPWQVSLRYDGA-----HLCGGSLLSGDWVLTAAHCFPERNR-----VLSRWR 216

  Fly   196 RDTDPDCENDLNGVRECAPPHIRVTIDRILPHAQY-------SELNYRNDIALLRLSRPVNWLQM 253
            ...        ..|.:.:|..:::.:..::.|..|       ||.| .|||||:.||.|:...:.
Human   217 VFA--------GAVAQASPHGLQLGVQAVVYHGGYLPFRDPNSEEN-SNDIALVHLSSPLPLTEY 272

  Fly   254 QNLEPVCLPPQRGRYANQ--LAGSAADVSGWGKTESSG-SSKIKQKAMLHIQPQDQCQEA-FYKD 314
              ::|||||.     |.|  :.|....|:|||.|:..| .:.:.|:|.:.|...|.|..| ||.:
Human   273 --IQPVCLPA-----AGQALVDGKICTVTGWGNTQYYGQQAGVLQEARVPIISNDVCNGADFYGN 330

  Fly   315 TKITLADSQMCAG-GEIGVDSCSGDSGGPLTVEANTASGNRYVYLAGVVSIGRKHCGTALFSGIY 378
               .:.....||| .|.|:|:|.||||||...|.:.:...|: .|.|:||.| ..|..|...|:|
Human   331 ---QIKPKMFCAGYPEGGIDACQGDSGGPFVCEDSISRTPRW-RLCGIVSWG-TGCALAQKPGVY 390

  Fly   379 TRVSSYMDWIESTIRAN 395
            |:||.:.:||...|:.:
Human   391 TKVSDFREWIFQAIKTH 407

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser7NP_572582.1 CLIP 29..74 CDD:197829
Tryp_SPc 131..388 CDD:214473 87/268 (32%)
Tryp_SPc 133..391 CDD:238113 88/269 (33%)
HPNNP_001362370.1 Hepsin-SRCR 51..159 CDD:401275
Tryp_SPc 163..400 CDD:238113 86/267 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.