DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser7 and HP

DIOPT Version :9

Sequence 1:NP_572582.1 Gene:Ser7 / 31917 FlyBaseID:FBgn0019929 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_005134.1 Gene:HP / 3240 HGNCID:5141 Length:406 Species:Homo sapiens


Alignment Length:306 Identity:88/306 - (28%)
Similarity:134/306 - (43%) Gaps:65/306 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   116 DQLPE-HPYCGSAFS-----FRLVGGHNTGLFEFPWTTLLEYETVSGGKDYACGASFIAQRWLLT 174
            |:||| ...||...:     .|::|||......|||    :.:.|| ..:...||:.|.::||||
Human   140 DKLPECEAVCGKPKNPANPVQRILGGHLDAKGSFPW----QAKMVS-HHNLTTGATLINEQWLLT 199

  Fly   175 AAHCIHTMGRNLTAAILGEWNRDTDPDCENDLN---GVRECAPPHIRVTIDRILPHAQYSELNYR 236
            .|       :||   .|......|..|....|.   |.::.      |.|::::.|..||::   
Human   200 TA-------KNL---FLNHSENATAKDIAPTLTLYVGKKQL------VEIEKVVLHPNYSQV--- 245

  Fly   237 NDIALLRLSRPVNWLQMQNLEPVCLPPQRGRYANQLAGSAADVSGWGKTESSGSSKIKQKAMLHI 301
             ||.|::|.:.|:  ..:.:.|:|||.:  .||.  .|....|||||:..:...:...:..||.:
Human   246 -DIGLIKLKQKVS--VNERVMPICLPSK--DYAE--VGRVGYVSGWGRNANFKFTDHLKYVMLPV 303

  Fly   302 QPQDQCQEAFYKDT---KIT----------LADSQMCAG-GEIGVDSCSGDSGGPLTV---EANT 349
            ..||||...:...|   |.|          |.:...||| .:...|:|.||:|....|   |.:|
Human   304 ADQDQCIRHYEGSTVPEKKTPKSPVGVQPILNEHTFCAGMSKYQEDTCYGDAGSAFAVHDLEEDT 368

  Fly   350 ASGNRYVYLAGVVSIGRKHCGTALFSGIYTRVSSYMDWIESTIRAN 395
                  .|..|::|.. |.|..|.: |:|.:|:|..||::.||..|
Human   369 ------WYATGILSFD-KSCAVAEY-GVYVKVTSIQDWVQKTIAEN 406

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser7NP_572582.1 CLIP 29..74 CDD:197829
Tryp_SPc 131..388 CDD:214473 78/276 (28%)
Tryp_SPc 133..391 CDD:238113 78/277 (28%)
HPNP_005134.1 CCP 33..87 CDD:153056
CCP 92..146 CDD:153056 4/5 (80%)
Tryp_SPc 161..399 CDD:214473 78/276 (28%)
Tryp_SPc 162..402 CDD:238113 78/278 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.