DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser7 and Tmprss11b

DIOPT Version :9

Sequence 1:NP_572582.1 Gene:Ser7 / 31917 FlyBaseID:FBgn0019929 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_795998.2 Gene:Tmprss11b / 319875 MGIID:2442893 Length:416 Species:Mus musculus


Alignment Length:280 Identity:92/280 - (32%)
Similarity:136/280 - (48%) Gaps:52/280 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   124 CG-----SAFSFRLVGGHNTGLFEFPWTTLLEYETVSGGKDYACGASFIAQRWLLTAAHCIHTMG 183
            ||     ||...|:.||......|:||...|..    .||.| ||||.|.:|:|||||||.....
Mouse   172 CGRRPRMSATYDRITGGSTAHKGEWPWQASLRV----NGKHY-CGASLIGERFLLTAAHCFQGTN 231

  Fly   184 --RNLTAAILGEWNRDTDPDCENDLNGVRECAPPHIRVTIDRILPHAQYSELNYRNDIALLRLSR 246
              :|||.:.                 |.| ..|.:::.::..|:.|..|.:..:.:|:|:::|:.
Mouse   232 NPKNLTVSF-----------------GTR-VTPAYMQHSVQEIIIHEDYVKGEHHDDVAVIKLTE 278

  Fly   247 PVNWLQMQNLEPVCLPPQRGRYANQL--AGSAADVSGWGKTESSGSSK-IKQKAMLHIQPQDQC- 307
            .|::  ..::..||||.     :.|:  .|....|:|||....:|.|. :.|||.:.|...:.| 
Mouse   279 KVSF--NNDVHRVCLPE-----STQIFPPGEGVVVTGWGSFSYNGKSPLLLQKASIKIIDTNTCN 336

  Fly   308 -QEAFYKDTKITLADSQMCAGG-EIGVDSCSGDSGGPLTVEANTASGNRYVYLAGVVSIGRKHCG 370
             :||:..    .:.|:.:|||. |..:|:|.||||||| |..|:..   ..||.|:||.|.: ||
Mouse   337 SEEAYGG----RIVDTMLCAGYLEGSIDACQGDSGGPL-VHPNSRD---IWYLVGIVSWGHE-CG 392

  Fly   371 TALFSGIYTRVSSYMDWIES 390
            .....|:|.||:||.:||.|
Mouse   393 RVNKPGVYMRVTSYRNWIAS 412

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser7NP_572582.1 CLIP 29..74 CDD:197829
Tryp_SPc 131..388 CDD:214473 85/264 (32%)
Tryp_SPc 133..391 CDD:238113 87/266 (33%)
Tmprss11bNP_795998.2 SEA 46..140 CDD:279699
Tryp_SPc 184..410 CDD:214473 85/264 (32%)
Tryp_SPc 185..413 CDD:238113 87/267 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.