DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser7 and CG31681

DIOPT Version :9

Sequence 1:NP_572582.1 Gene:Ser7 / 31917 FlyBaseID:FBgn0019929 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_722789.1 Gene:CG31681 / 318882 FlyBaseID:FBgn0051681 Length:264 Species:Drosophila melanogaster


Alignment Length:280 Identity:79/280 - (28%)
Similarity:117/280 - (41%) Gaps:66/280 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   131 RLVGGHNTGLFEFPWTTLLEYETVSGGKDYACGASFIAQRWLLTAAHCIHTMGRNLTAAIL---- 191
            |:|||....:...||..     :|.....:.||....:.|.:||||||:    .|:|...|    
  Fly    28 RIVGGSYIPIEYVPWQV-----SVQNNSLHCCGGVIYSDRAILTAAHCL----SNVTVTDLSVRA 83

  Fly   192 --GEWNRDTDPDCENDLNGVRECAPPHIRVTIDRILPHAQYSELNYR-NDIALLRLSRP------ 247
              ..|::....                  :.:.:.:.|.:|....|. .|||:|.|..|      
  Fly    84 GSSYWSKGGQV------------------LKVLKTIAHPKYVPKLYNPYDIAVLILEAPLRLGGT 130

  Fly   248 VNWLQMQNLEPVCLPPQRGRYANQLAGSAADVSGWGKTESSGSS--KIKQKAMLHIQPQDQCQEA 310
            |..:.:....||             ||:....||||.|..:.|.  .|.|...:.|..:..|.:|
  Fly   131 VKKIPLAEQTPV-------------AGTIVLTSGWGYTRENSSFLWPILQGVHVAILNRTDCLKA 182

  Fly   311 FYKDTKITLADSQMCAGGEIGVDSCSGDSGGPLTVEANTASGNRYVYLAGVVSIGRKHCGTALFS 375
             ||...||:  ..:||.|: ..|:|.||||||| :| .|..|:|  .|.|:||.| ..|||.  .
  Fly   183 -YKHVNITI--DMICADGQ-RWDTCQGDSGGPL-IE-TTKGGHR--QLIGMVSWG-DGCGTN--P 236

  Fly   376 GIYTRVSSYMDWIESTIRAN 395
            |:|..::.:.:||:.|::.|
  Fly   237 GVYEDIAFFHNWIKYTVKKN 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser7NP_572582.1 CLIP 29..74 CDD:197829
Tryp_SPc 131..388 CDD:214473 75/271 (28%)
Tryp_SPc 133..391 CDD:238113 76/272 (28%)
CG31681NP_722789.1 Tryp_SPc 28..249 CDD:214473 75/271 (28%)
Tryp_SPc 29..250 CDD:238113 75/271 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.